KEGG   Gallus gallus (chicken): 424685Help
Entry
424685            CDS       T01006                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1 (EC:3.1.2.15)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    424685 (USP1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     424685 (USP1)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   424685 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 794 aa AA seqDB search
MPGVLPSDGSAPPRGSPSRKNRLSLKLFQKKEAKRALDFTEPPENEQKGAELRGAEIDQV
VPAAQPPSLVSCEKKDNMLPFVGLNNLGNTCYLNSVLQVLYFCPGFKTGVKHLYNIISKK
KESLKDEGELKAEKGNCKEDPLASYELICSLHSLILSVEQLQASFLLNPEKYTDELATQP
RRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEELNKLPLEEPKAKVEEK
INPNSESNGTGNSAEEEEENAPGSHVGEVAEDKLPKGNGKRKSDAEGGNAKKKSKVSKEQ
IAAEENQRQTRSKRKATGEKLENQSDAIAKCSTENESAKPTQKKSRLKLNWLKSSCKQPS
ILSKFYSLGRLSTNLGSKDPEYDDCELEESSAKCENGNDIKEEDCHEPASPVESHTEKGT
EKEPKNEGTELAVFELVEKLFQGQLVLRTRCLECECFTERREDFQDISVPVQEDELSKTE
ESSEISPEPKTEMKTLKWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVIT
IHLKCFAASGLEFDCYGGLSKINTPLLTPLKLSLEEWSTKPTNDTYGLFAVVMHSGITIS
SGHYTASVKITDLNSLELDKGNFITAQMCETIKPEPLNEEEARTAAEDYDDGEVSFRVNG
NAQPGKVLNKKNMEAVGLLGGQKSKSDCDLYSKPASSEKVLNIVTENRNPESAPANGSVE
CSTERGDQNGVAFSGLENKALYVLQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPTSSS
TSTPYLLFYKKIVE
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggtgctcccgagcgacggcagcgcgccgccgcggggcagcccgtccaggaag
aaccgcctgtcgctgaagctcttccagaagaaagaggcgaagagagcgctggatttcacc
gagccgccggagaatgagcagaagggcgcggagctccgcggcgcagagattgaccaggtt
gttcctgcagcacagcctccctcgcttgtcagctgtgagaagaaggacaacatgttgccc
tttgtgggcttgaataatcttggcaacacctgttaccttaacagcgttcttcaggtatta
tatttttgtcctggttttaaaacgggagtcaaacacttatataatatcatttcaaagaag
aaagaatcgttgaaggatgaaggagagctaaaagcagaaaagggaaattgtaaagaagat
ccactggcaagttatgaactgatctgcagtttgcactcgttgattctttctgttgaacaa
cttcaagccagctttcttttaaacccagagaaatacacggatgaacttgctactcagcca
cgaaggctgctgaacacccttagagagctcaaccctatgtacgaaggctacttgcagcac
gatgcccaggaagttctgcagtgcatccttggtaatattcaagaaacatgtcagctactg
aagaaggaagaactgaataaactgcccctggaagagcccaaagctaaagtggaggaaaaa
attaatccaaattccgagagcaatggaactggcaactctgctgaggaggaggaggagaac
gcaccgggtagccatgtgggagaggtagctgaagataagctacccaaaggaaatgggaaa
agaaaaagcgatgctgaaggtggcaacgcaaagaaaaagtccaaagtgtcaaaagaacaa
attgcagcagaagaaaatcaaagacaaaccaggtcgaagaggaaagcaacaggagaaaag
ctggagaatcaaagtgatgccattgccaagtgttccactgagaacgagagcgcaaagcca
acgcagaagaagtcacgacttaaattaaactggttaaaatcctcatgcaaacagccaagt
attctgtccaaattttatagtctggggaggttaagtacaaatttgggatccaaagaccca
gagtacgatgactgtgagcttgaagagtcatctgccaagtgtgaaaatggtaacgatatt
aaagaagaagattgtcatgaaccagcatctcctgtggaaagccatactgaaaaaggaact
gaaaaagaaccaaaaaacgaaggtacagagttggctgtttttgaactagtggagaaattg
ttccagggccagttagtactgagaacgcgatgcttggagtgcgagtgctttactgaaaga
agagaggacttccaggacatcagtgttccagtgcaagaagatgaactttctaaaactgaa
gaaagttctgaaatttctccagagccaaaaacagaaatgaagactctgaaatgggcaatt
tcacagtttgcatcggtggaaaggattgtgggagaggataagtacttctgcgagaactgc
catcattacacagaagcggagcgcagccttttatttgataaaatgcctgaagttataaca
attcatttgaagtgctttgctgctagtggcttagagtttgattgctacggcggactgtcg
aagataaacactcccttactgacgccactcaaactgtcactggaagaatggagcacaaag
ccaaccaatgacacctatgggttatttgcagtggtgatgcacagtggcattacaattagc
agcggacactacacagcttctgtcaaaatcacagatctcaacagcctggagttagacaag
ggaaacttcatcactgcccaaatgtgcgaaaccattaaaccagaaccactgaatgaggag
gaagcaaggactgctgctgaagactacgacgacggtgaagtctcttttagggtcaacggc
aatgcacagccaggtaaagttctgaacaaaaagaacatggaagctgtgggacttcttggg
ggacagaagagcaagtctgactgtgacctgtacagcaaaccagcaagcagcgagaaggtt
ctcaatatagttactgagaacagaaaccccgagtctgcccctgctaatggcagcgtggag
tgcagcactgaacgcggcgatcagaacggggttgctttcagtggactggaaaacaaagct
ctgtacgtcctgcagagcctgaaagagtacgaagggaagtggttgctttttgatgattct
gaagtgaaagttacagaggaaaaggacttcctgaattctctgtctcccacgtcgtcatct
acatcaactccttacctactgttttataagaaaattgtagagtga

DBGET integrated database retrieval system