KEGG   Gallus gallus (chicken): 424860Help
Entry
424860            CDS       T01006                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    424860 (PAK2)
   04012 ErbB signaling pathway
    424860 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    424860 (PAK2)
  Cellular commiunity
   04510 Focal adhesion
    424860 (PAK2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     424860 (PAK2)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   424860 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 521 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSYGGKDPLSANHSLKPLPSVPEERKPRNKIISIFSSTEKGS
KKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKDTAKQKYLSFSAPEKDGFPSGTPTTNAKGSEPSTAVADDDDDDEEAPPPII
APRPDHTKSIYTRSVIDPIPAPAGDASVDGGTKSGDKQKKKTKMSDEEIMEKLRTIVSIG
DPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKN
PNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQ
VIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK
VDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEM
DVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccaccagctcctcctgtgcggatgagcagt
tatgggggaaaggacccgttgtctgccaaccacagcttgaaacctctgccctccgtacca
gaagagagaaaacctaggaataaaatcatctccatattctctagcactgaaaaaggaagc
aagaagaaggaaaaggaacgaccagaaatctccccgccgtcagactttgagcatactatc
catgttggctttgatgctgtcactggagagttcactggaatgccagagcaatgggctcgg
ttgctacagacctcaaacatcaccaagttagaacagaagaaaaaccctcaggcggtacta
gatgtgctgaaattctacgactccaaagacacagcaaaacagaaatatctgagcttttct
gctccagaaaaagatggcttcccttcaggaacaccaacgaccaatgccaaaggttcagag
ccatcaacagctgtggcagatgacgatgacgatgatgaagaagcacctcctcctattatt
gctccgcggccagatcacacgaaatcgatttatacacggtctgtaattgaccccatccct
gcaccagctggtgacgcttctgttgatggtgggacaaagtcaggtgataagcagaaaaag
aagaccaaaatgtcagatgaagagatcatggaaaaactacgtaccattgtgagcataggt
gatcccaagaaaaaatacaccagatatgaaaaaattgggcagggggcttcaggtacagtt
ttcacagctattgacgtggctactgggcaggaggttgctatcaaacagataaacctgcag
aaacagcccaagaaggagttgattattaatgagatcttggtaatgaaggaactaaagaac
cccaacatagtcaacttcctggacagttacctcgtaggagatgaactgtttgtggtgatg
gagtatctagctggaggctcactaacagatgtggttacggaaacatgtatggatgaagca
cagattgctgctgtttgcagggagtgcttgcaagcgcttgagttcctccatgccaaccag
gtcatccacagagatataaagagcgacaacgtgctgctaggaatggatggatcagttaaa
ctaaccgactttggtttctgtgctcagatcaccccagagcagagcaagcgcagcactatg
gttggaacaccttactggatggctcctgaagtcgtcacacggaaagcctatggccctaaa
gtggatatctggtccctaggcatcatggctattgagatggtggaaggagaacccccgtac
ctcaatgaaaaccccctgagggcgttatatttgatagcaactaacggcacaccagagctt
cagaaccctgagaaactgtccccaatattccgggatttcttaaaccgatgtttggagatg
gatgttgagaaaagaggatcagccaaagaattgctacagcatcccttcttgaaattggcc
aaacctctgtctagcttgacgccactgatcctggcagccaaagaagcaatgaagagtaac
cgctaa

DBGET integrated database retrieval system