KEGG   Gallus gallus (chicken): 424877Help
Entry
424877            CDS       T01006                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
  KO
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    424877 (EHHADH)
   01212 Fatty acid metabolism
    424877 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    424877 (EHHADH)
   00650 Butanoate metabolism
    424877 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    424877 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    424877 (EHHADH)
   00310 Lysine degradation
    424877 (EHHADH)
   00380 Tryptophan metabolism
    424877 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    424877 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    424877 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    424877 (EHHADH)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     424877 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     424877 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     424877 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
9
AA seq 726 aa AA seqDB search
MAQYARGAAAVAVIRLRNPPVNALSLTVLQALEDGLKRADADPSVKAVTICGENGKFSAG
ADIRGFSSPKKQGLGLGPIVSLIERSEKPVVAAIEGIALGGGLEVALGCHYRIAHVQARM
GLPEVTIGLLPGAEGTQRLPRLVGVPAALDIITTGRHIPATEALKLGLVDEVVEENTVEA
AIRLANKLIGQPLGHRRLSLKPVPRLPNMEAFLSEALVKVKKRAQGCLAPELCFQAIKAA
TEQPFADGVRKERELFNILLTSGQAKALQYAFFAERAVEKWTTPSGASWKSASPQPIRKA
AVIGLGTMGRGIVTSLVKAKIPVVALEQNLEYLNTGRKAVMLLLEREAMKMEQGAQTLDF
HNPAQLQFTVDFDVLRDVDLVIEAVFENMALKKEIFSKLSRICKPEAFLCTNTSALNIDD
IASVTGRPQQVIGTHFFSPAHVMRLLEIIYGRHTSPNTIATAIQLAKVMKKVGVVVGNCF
GFVGNRMMFPYVQQAVFLLEEGSRPEDVDQVLEDFGFKIGPFRMSDLAGLDVGWRSRKDQ
GLTGPSLAPGTPVRQRHGYRYSPLPDLLCEKGRFGQKTGKGWYQYEKAGGRTAKPDPWIH
SFLREYRDTHQIKTRFIDQEEILERCLFTLINEGFDILAEGIASGPEHLDVVYINGYGWP
KHRGGPMFYASIVGLPNILTKLQKYSEIHPDVPQLRPSAFLKKLVAVGNPPLNDWMSYLH
RQSNKL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtacgcgaggggcgccgcggccgtggccgtcatccggctccgcaacccgccg
gtcaacgcgctgagtttgacagttctccaggcattagaggatggactgaaaagagcagac
gcggatccttcagtgaaagctgtcacaatttgtggcgaaaatgggaagttcagtgcaggc
gctgacattcgaggattttcttctccaaagaaacagggtcttggcttgggccccatagtt
tctctcatagaaaggagcgagaagcctgttgtggctgccattgaaggcattgccttggga
ggaggcctggaggtggcacttggctgtcactatcgtatcgcacatgtgcaggcacggatg
ggcttacctgaagtcacaattgggttactcccaggtgctgaaggcactcagcggctcccc
agactggttggggttcctgctgctctggatataattactacaggaagacacattcctgca
actgaagcactgaagctgggcttggttgatgaagttgtggaagagaacacagttgaagca
gcaatccgtttggcaaacaaattgattggccagcccttgggacaccgcaggctcagcctg
aagccagtccccagattgcccaacatggaagcatttctcagtgaggctctcgtgaaggtg
aagaaacgggcccaagggtgcctggcaccagagctgtgcttccaagcaatcaaagctgcc
acagagcagccatttgcagatggagtccggaaggagagagagctgtttaacatcctgctg
acttcaggccaggccaaagcactgcagtatgctttctttgcagagagagcagtggagaag
tggacaacacccagtggagcttcgtggaaaagtgcttcccctcagcccatccgcaaagca
gctgtgatagggctgggaacaatgggccgaggcattgtgacttctctggttaaggccaag
atacctgtggtggccctggagcagaatctggagtatctgaacacaggaagaaaagccgtg
atgctccttttggaacgtgaggctatgaaaatggagcagggtgcccaaaccctggatttc
cataaccctgcacaactccagttcactgtggactttgatgtgttgcgggatgtagatcta
gttattgaagctgtcttcgagaacatggcactaaagaaggaaatattcagcaagctatca
agaatctgcaagccggaggcctttctgtgtacaaacacatcagccctgaatattgatgat
atagcttctgtcaccggccgcccacagcaggtcattggcacacacttcttctcccctgct
catgtgatgaggctattagaaataatctatggccgtcacacgtcccccaacaccattgcc
acggccattcagctagctaaagtgatgaagaaagttggagtggtggtagggaactgtttc
gggtttgttgggaaccgaatgatgtttccgtacgtacaacaggcagttttcctcttagag
gaaggaagcagaccagaagacgtagatcaggttcttgaagattttgggtttaagataggg
cccttccgaatgtctgatcttgctgggctggatgtgggctggaggtctcgaaaggaccag
ggccttactgggccctcactggctccaggaacacccgtccgccagcggcatggctatcgc
tacagcccgctgcctgaccttctgtgtgagaaaggcaggtttggccagaagacaggaaaa
ggctggtatcagtacgagaaggctgggggtaggacagccaaaccagacccatggattcac
agctttctgcgtgagtacagggacacccatcaaatcaagacccgctttatagaccaggag
gaaatcctggagcgttgcttgtttactcttattaatgaaggatttgacatcctggctgag
ggaatagcatcaggcccagaacaccttgatgtagtttatatcaatggttatggatggcca
aagcacaggggtggccccatgttctatgcttccattgtggggctccctaacattctgact
aagctgcagaaatactctgagatccaccctgatgttccccagctacgtcccagtgccttc
ctgaaaaagttggtggctgtggggaaccctcctctcaatgactggatgtcctacctacac
aggcagagcaacaagctgtga

DBGET integrated database retrieval system