KEGG   Gallus gallus (chicken): 424888Help
Entry
424888            CDS       T01006                                 

Gene name
CPB1
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     424888 (CPB1)
Peptidases [BR:gga01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   424888 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
9
AA seq 417 aa AA seqDB search
MWAFLVLVGAAVASAHLQDQTFDGHKVFRVIPQDNEQVEIIRSLASKMKLDFWQPDSVKM
VKPKRQVDFRVEADKTLEVEHLLKENKMDFNVLIDNLQTALHAQFDSKVRGTGHSYEKYN
TWDTIAAWTADIAAENPTLVSRSVIGETYEGQPLYLLKLGKSGTNKKAIFMDCGFHAREW
ISPAFCQWFVKEAVETYGTDSTMTKLLNSLDFYVLPVVNIDGYVYSWTKDRMWRKTRSKN
TGSSCIGTDLNRNFNAGWCELGASDRPCASTYCGSAPESEKESKALADFIRENLSTIKAY
LTVHSYSQLLVFPYSYTYKLAKDYNELNTVASAAIQRLTSLYNTNYEYGPGAATVYPAAG
GSDDWAYDQGIKYSFTFELRDTGKYGFLLPESQIKPTCEETMLAVKYIASYVLDHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgttcttagttctcgtaggtgctgcagttgcttctgctcacctgcaagatcag
acttttgatggccacaaggtgtttcgtgtgattccccaggacaatgagcaggtggaaatc
atccgctctcttgccagcaaaatgaagcttgacttttggcagccagactccgtgaaaatg
gtaaagccaaaaagacaagttgatttccgagttgaagctgacaagactttggaggttgaa
catctcttgaaagaaaacaaaatggatttcaatgttctgatagacaacctgcagactgcg
ctgcatgctcagtttgacagcaaagtccgtggcactggtcacagctatgaaaaatacaac
acctgggatacgatagctgcttggactgctgacattgctgctgagaatccaaccctggtc
tctcgcagtgtaattggggaaacatacgaaggacagccactgtaccttctcaaattggga
aaaagcggtacgaataagaaggccatcttcatggactgtggttttcatgcaagagagtgg
atctcccctgctttctgccagtggtttgtgaaagaagctgttgagacctacggaacagat
agtaccatgaccaaacttctcaacagcttggacttctatgttttgccagttgttaatatt
gatggttacgtttacagttggacaaaagaccgtatgtggagaaagacacgctctaaaaac
acaggcagctcttgcattggtaccgatctcaacaggaatttcaatgctggctggtgtgaa
ctgggggcctcagatagaccctgcgcttccacttactgtggctctgcacctgagtctgaa
aaggagagtaaggctttggctgattttattcgtgaaaatctctctacaatcaaggcatat
ctgactgtgcactcctattcccagctgctagtgtttccttattcgtacacttataaactt
gcaaaggattacaacgaactgaacaccgttgccagtgctgcaatccaacgactgaccagt
ttgtacaacaccaactacgaatacggcccaggagctgcaacagtctaccctgctgcagga
ggctctgatgactgggcttatgatcaaggcatcaagtactctttcacttttgagctccgt
gacactggtaaatatgggtttcttctgcctgagtctcagataaagccaacctgtgaggag
actatgcttgctgttaaatacattgccagttatgtccttgatcacttgtattaa

DBGET integrated database retrieval system