KEGG   Gallus gallus (chicken): 424936Help
Entry
424936            CDS       T01006                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    424936 (ALPI)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     424936 (ALPI)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   424936 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
9
AA seq 709 aa AA seqDB search
MAPGRAGDTGRAGPQDVPECYQPIVSPAAGAQPSGRTGQGIKGCVSPSPAHRRPSGRNVG
WAAWDGCSLPGSASSLFSSPRSLPLRPQTPRRPHTTGMRGPGGGWKQPSPCSQQRSEPKT
SSSSWVMVSAPRVLPFPMSPPSAPWGQSCPPAAGGPLFPGSMALEREGRTVSSHSALSPL
TAGMGLPTVSAARIYKGQLAGGSGEESVLAMETFPHVALAKTYTIDRQVPDSAGTGTAYL
CGVKANSKTVGLSGAAVYGKCRTAFGNEVDSVLHRARLAGKSVGIVTTTRVQHASPAAAY
AHSASRSWYADANMPRETLRDGCKDIAHQLVHNTDINVILGGGRAYMSPRWTPDPEYPED
PAQNGTRRDGRDLVAEWLSTREGARYVWDKKGLDAVDDTSVSHLMGLFEPKDMRYELNRN
ATTDPSIVEMTEKAIRILRRNPNGFFLFVEGGRIDHGHHSGRAKQALMEAVMLDRAVARA
GELTEPSDTLTVVTADHSHVFTFGGNTLRGASIFGLAPKKAKDKRAYTSILYGNGPGYSI
RDGGRPAASLPAVGRILLQEKGWGGGLVPFWGSLGQKLPQHQGGGSCFMQRAEELPPAPF
LLLSPQRTRTTGSRRPSPLTWRPTVGRTWWCWPRAPWPTSSMGCRSSTMLPMPLLMPRAS
SLMMPDPAVVDTVGPLAAPSTPHGPHSLSWPSAWLPSWWWAERPYQALL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccccggggagggctggggacaccgggagggcagggccacaagatgtccctgaatgt
tatcagcccatcgtctcacccgcagcaggggctcagccctccggcaggacagggcagggc
ataaagggctgtgtatcccccagccctgcacaccggcggccatcaggaaggaacgtgggc
tgggcagcatgggacggctgctccctgccaggatctgcttcctccttgttttcctcaccc
cgctcactgccactgcgacctcagacgccgagaagaccccacactactggaatgaggggg
ccaggaggaggctggaagcagccctcgccttgcagccagcagcgcagcgagccaaaaaca
tcatcctcttcgtgggtgatggtgagtgctccacgggtgctgccatttcccatgtcaccg
ccttcagcaccctggggacaaagctgccctccagcagctggtgggcccctcttccctggt
agcatggccctggaaagggagggcaggaccgtctccagtcacagcgctttgtcacccctc
accgcaggcatggggctgcccacggtgtcagcagcccggatctacaaggggcagctggcc
ggtggctcgggtgaagagagcgtcttggccatggagacgtttccccacgtggccctggcc
aagacctacaccatcgaccggcaggtgcctgacagcgccggcacaggcacagcctacctg
tgtggggtgaaggccaactccaagacggtggggctgagtggggcggccgtctacggcaaa
tgccgcacagcattcggcaatgaagtggactccgtcctgcaccgggcccggctggcaggt
aagtcggtgggcatcgtgaccaccacgcgggtgcaacacgcgtcccctgctgctgcctat
gcgcactcggccagccgtagctggtacgccgatgccaacatgcctcgggagaccctgcgg
gatggctgcaaggacatcgcccaccagctggtgcacaacactgacatcaacgtgatcctg
ggcggcgggagggcctacatgtcccccaggtggaccccggaccctgagtacccggaggac
ccggcgcagaacggcaccaggagggacggacgggacctggtggccgaatggctcagcacc
agggagggtgcgcgctacgtctgggacaagaagggcctggatgcagttgatgacacctct
gtgagccacctcatgggcctctttgagcccaaggacatgaggtatgagctgaaccgcaac
gccaccacggacccctccatcgtggaaatgacggagaaagccatccgcatcctgcgcagg
aaccccaacggcttcttcctctttgtggaaggtggaaggattgaccacgggcaccacagc
ggccgggccaagcaggcgctgatggaggccgtcatgctggaccgggcagtggcgcgggca
ggagagctgacggagccctctgacactctgaccgtggtgacggccgaccactcgcatgtc
ttcaccttcgggggcaacacgctgcgaggagcctccatcttcgggctggcccctaagaaa
gcgaaggacaagcgagcctacaccagcatcctctacggcaatgggccgggatacagcatc
cgtgatgggggccgcccagcagccagcctcccagctgtgggtaggattctactgcaagag
aagggatggggtgggggcctggtgcctttctggggttcacttggacagaaactgccccag
caccagggtggtgggagctgcttcatgcaaagggcagaggagctgcccccggcaccattt
ctcctgctctctccacagaggacaaggactacaggcagcaggcggccgtcccccttgact
tggagacccacagtggggaggacgtggtggtgctggcccagggccccatggcccacctct
tccatggggtgcaggagcagcactatgttgcccatgccattgcttatgccgcgtgcctca
agccttatgatgccagaccccgctgtggtggacaccgtagggcctctggcagcacccagc
actccccacggcccccactcgctctcctggccctctgcatggctgccttcatggtggtgg
gctgagagaccctaccaagccctcctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system