KEGG   Gallus gallus (chicken): 424936Help
Entry
424936            CDS       T01006                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gga00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
9
AA seq 709 aa AA seqDB search
MAPGRAGDTGRAGPQDVPECYQPIVSPAAGAQPSGRTGQGIKGCVSPSPAHRRPSGRNVG
WAAWDGCSLPGSASSLFSSPRSLPLRPQTPRRPHTTGMRGPGGGWKQPSPCSQQRSEPKT
SSSSWVMVSAPRVLPFPMSPPSAPWGQSCPPAAGGPLFPGSMALEREGRTVSSHSALSPL
TAGMGLPTVSAARIYKGQLAGGSGEESVLAMETFPHVALAKTYTIDRQVPDSAGTGTAYL
CGVKANSKTVGLSGAAVYGKCRTAFGNEVDSVLHRARLAGKSVGIVTTTRVQHASPAAAY
AHSASRSWYADANMPRETLRDGCKDIAHQLVHNTDINVILGGGRAYMSPRWTPDPEYPED
PAQNGTRRDGRDLVAEWLSTREGARYVWDKKGLDAVDDTSVSHLMGLFEPKDMRYELNRN
ATTDPSIVEMTEKAIRILRRNPNGFFLFVEGGRIDHGHHSGRAKQALMEAVMLDRAVARA
GELTEPSDTLTVVTADHSHVFTFGGNTLRGASIFGLAPKKAKDKRAYTSILYGNGPGYSI
RDGGRPAASLPAVGRILLQEKGWGGGLVPFWGSLGQKLPQHQGGGSCFMQRAEELPPAPF
LLLSPQRTRTTGSRRPSPLTWRPTVGRTWWCWPRAPWPTSSMGCRSSTMLPMPLLMPRAS
SLMMPDPAVVDTVGPLAAPSTPHGPHSLSWPSAWLPSWWWAERPYQALL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccccggggagggctggggacaccgggagggcagggccacaagatgtccctgaatgt
tatcagcccatcgtctcacccgcagcaggggctcagccctccggcaggacagggcagggc
ataaagggctgtgtatcccccagccctgcacaccggcggccatcaggaaggaacgtgggc
tgggcagcatgggacggctgctccctgccaggatctgcttcctccttgttttcctcaccc
cgctcactgccactgcgacctcagacgccgagaagaccccacactactggaatgaggggg
ccaggaggaggctggaagcagccctcgccttgcagccagcagcgcagcgagccaaaaaca
tcatcctcttcgtgggtgatggtgagtgctccacgggtgctgccatttcccatgtcaccg
ccttcagcaccctggggacaaagctgccctccagcagctggtgggcccctcttccctggt
agcatggccctggaaagggagggcaggaccgtctccagtcacagcgctttgtcacccctc
accgcaggcatggggctgcccacggtgtcagcagcccggatctacaaggggcagctggcc
ggtggctcgggtgaagagagcgtcttggccatggagacgtttccccacgtggccctggcc
aagacctacaccatcgaccggcaggtgcctgacagcgccggcacaggcacagcctacctg
tgtggggtgaaggccaactccaagacggtggggctgagtggggcggccgtctacggcaaa
tgccgcacagcattcggcaatgaagtggactccgtcctgcaccgggcccggctggcaggt
aagtcggtgggcatcgtgaccaccacgcgggtgcaacacgcgtcccctgctgctgcctat
gcgcactcggccagccgtagctggtacgccgatgccaacatgcctcgggagaccctgcgg
gatggctgcaaggacatcgcccaccagctggtgcacaacactgacatcaacgtgatcctg
ggcggcgggagggcctacatgtcccccaggtggaccccggaccctgagtacccggaggac
ccggcgcagaacggcaccaggagggacggacgggacctggtggccgaatggctcagcacc
agggagggtgcgcgctacgtctgggacaagaagggcctggatgcagttgatgacacctct
gtgagccacctcatgggcctctttgagcccaaggacatgaggtatgagctgaaccgcaac
gccaccacggacccctccatcgtggaaatgacggagaaagccatccgcatcctgcgcagg
aaccccaacggcttcttcctctttgtggaaggtggaaggattgaccacgggcaccacagc
ggccgggccaagcaggcgctgatggaggccgtcatgctggaccgggcagtggcgcgggca
ggagagctgacggagccctctgacactctgaccgtggtgacggccgaccactcgcatgtc
ttcaccttcgggggcaacacgctgcgaggagcctccatcttcgggctggcccctaagaaa
gcgaaggacaagcgagcctacaccagcatcctctacggcaatgggccgggatacagcatc
cgtgatgggggccgcccagcagccagcctcccagctgtgggtaggattctactgcaagag
aagggatggggtgggggcctggtgcctttctggggttcacttggacagaaactgccccag
caccagggtggtgggagctgcttcatgcaaagggcagaggagctgcccccggcaccattt
ctcctgctctctccacagaggacaaggactacaggcagcaggcggccgtcccccttgact
tggagacccacagtggggaggacgtggtggtgctggcccagggccccatggcccacctct
tccatggggtgcaggagcagcactatgttgcccatgccattgcttatgccgcgtgcctca
agccttatgatgccagaccccgctgtggtggacaccgtagggcctctggcagcacccagc
actccccacggcccccactcgctctcctggccctctgcatggctgccttcatggtggtgg
gctgagagaccctaccaagccctcctctag

DBGET integrated database retrieval system