KEGG   Gallus gallus (chicken): 425007Help
Entry
425007            CDS       T01006                                 

Gene name
SI, MGAM
Definition
sucrase-isomaltase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
gga  Gallus gallus (chicken)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    425007 (SI)
   00500 Starch and sucrose metabolism
    425007 (SI)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     425007 (SI)
    3.2.1.20  alpha-glucosidase
     425007 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
9
AA seq 1849 aa AA seqDB search
MSRPQGITLKELSAQQQITTLHPTSSARRAHVMVSVCCKMGKRKFSGLEITLIVLFCLVV
VVAIILIALLATGVPAVKTTEFTPECPNILTVERIDCIPDQTATKSICDLRGCCWSPQSD
TSVPWCYFSKNHGYEVDGSTRSTQTGFEATLRRLSSPSLFGKDINTVLLTGEYQTANRFR
FKITDPTTQRFEVPHEQVGSFSGPAASNLNYRVEVRSNPFGIVVTRVSGKVLFDTTIGPL
QYADQFLQLSIKLPSSNIYGVGEHVHKQYRHDLNWKTWPLFSRDVGPSDQMHNLYGVQTF
FMCLEDSSGASFGVFLMNSNAMEFALQPAPAVTYRTIGGILDFYIFLGNTPEQVVQEYLQ
FVGLPLMPSYWSLGFQLSRWNYGSLDEVKAVVERNRLIGLPYDVQITDIDYMEGKKDFTY
DKVLFSDLPNFATYMHNSGQKYVIILDPAISTQPLVDGSQYGSYVRGENRKVWVNESDGV
TTLVGEVWPGEAVFPDFTNPECTSWWVEECRLFYNTVPYDGIWIDMNEVSNFVQGSSKGC
EQNDLNYPPFTPNIVDKLMFSKTLCMDAVQKWGKHYDVHSLYGYSMAIATRQAIETVLPG
KRSYLISRSTFIGSGKHTGHWLGDNAATWEQLRWSIPGMLEFNIFGFPYIGADICGFVFD
TTEELCRRWMQVGAFYPFSRNHNAEGYIHQDPAVFGADSVLVQTSKHYLSIRYTLLPYLY
TLFYRAHTRGDTVVRPVLHEFYSDEGTWAVDRQFLWGPGLLISAVMDQGVDIIDAYIPDA
VWYEYETGARISERKQWTRMYLPADKLGLHLRGGYIYPIQQPATTTVESRQNPLGLIIAL
DENNTASGELFWDDGESTGTIESNNYIYYEFTVSNNRLQMNVINSVYVDPNNLKFEEIKI
LGVLQEVTTVTVSLNNAVQTSSHNITYYPTEKVAHITGLQLELGRSYTVEWTQQQSINER
FDCYPGIDSTREKCEQLGCVWDQAPSDPNSPSCYFSSDNVYSVGEVEYSSSGLAANLNLS
SANTRANDNYTAPIGTLRLEVKYHTNSMLQFKIYDYQNARYEVPIQLNLPTSPTSTAEGR
LYDVSIQKKPFGIQVRRKSTGTVVWDSQLPTFTFSDMFIQISTRLPSQYIYGFGETEHTT
YRRNMNWNTWGMFTRDQSPADHLNSYGHHPFYMALEEDSNAHGVLLLNSNAMDVTLQPTP
ALTYRTIGGILDFYMVLGPTPELVVQEYTELIGRPVMPPYWSLGFQLCRYGYRNDSEVAQ
LVEEMKATQIPYDVQYVDIDHMERQLDFTLSSRFTGLPALVNKIKGEGMRFIIILDPTIS
GNETNYPTFSRGVDNDVFMKWPNSNDIIYSKVWPFLPNVQVNESLPEQTQIQLFGAHAAF
PDFLRNSTVEWWKREIMEFYNNPTDPSKSIKFDGLWIDMNEPATFMNAAFGGCRNEILNN
PPYMPHLGYRSEGLTYKSPCMEGQQYLPDGTPVRHYDVHSLYGWAQTRPTLEALQSVTRE
RGIVITRSTYPSSGRWAGHWLGDNAAAWDQLSKSIIGMMEFSLFGISYTGADICGFFNDS
EYELCLRWMQLGSFYPYSRNHNEKGTKRQDPASWNSTFVDISRHVMNIRYTLLPYLYTLL
HEAHVHGSTVVRPVLHEFAQERATWDIFEQFLWGPALLISPVMAPGAVTVNAYLPNARWY
DYHTDEHINARGEYRVLSAPLEHINLHIRGGYILAWQEPANTTFFSRQNPMGLTVALNDS
LLAEGQLYWDDGVRIDAYENGAYLLTSFSAQQNALEIKVEHHGYSDPNNLMFTEIKVLGV
PTTVQQVNVTQNGVIIPSAHVLSYDSSKQVMRIMQLQLHLGQSYTVQWS
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgacctcaaggaataaccttgaaagaactctcagcccaacagcagatcactact
ttgcatcctacctcttcagccaggagagctcacgtgatggtctctgtctgctgtaagatg
ggcaagaggaagttcagtggcctggaaatcactctcattgtcctcttttgcctggtggtg
gtggtggccattatcctcattgcgcttttagcaacaggagtacctgcagtcaaaactacg
gaatttacaccagaatgtccaaacatattaacagtggagagaattgactgcatcccggat
caaacagcaacaaagagcatctgtgacttgcgtggctgctgctggagtccccagagtgat
accagtgtaccctggtgctatttctctaaaaaccatgggtacgaagtggatgggtcaaca
agatcaactcaaacaggatttgaggccacgttaagaaggctgtcatcaccttctctcttt
ggaaaagatatcaacactgtcctcctcacaggagagtatcagacagcaaatcgcttccgg
ttcaagattactgatcctacaacacaaagatttgaagtcccccatgagcaagtgggctct
ttcagtggacctgcagcctccaatttaaactacagagtggaagtgaggtcaaatcccttt
ggtattgtggtgaccagagtgagcgggaaagtgctttttgatactaccataggaccactg
cagtatgctgaccagtttttacagctttcaatcaagctacctagcagcaacatttatggt
gtgggagagcatgtgcataagcagtaccgacatgatctcaactggaaaacctggcctcta
ttcagcagggatgttggtccctctgaccaaatgcataacttatacggagttcagactttc
ttcatgtgtttggaagacagcagtggagcctcttttggtgtattcctgatgaatagcaac
gccatggagttcgcactgcagcctgctccagcagtgacctacagaaccattggcggcatc
cttgatttctatatcttcttggggaacactccagagcaagtagtgcaagagtatttgcag
tttgtgggactcccactgatgccttcctactggagtctgggcttccagctcagccgctgg
aattatggctctctggatgaggtgaaggctgttgtggagaggaaccgtctgattggactc
ccttatgatgttcagatcactgacattgattacatggaaggaaagaaagatttcacatac
gacaaagtgctgtttagtgatcttcctaattttgcaacttatatgcataacagtggacaa
aaatatgttatcatattggatcctgctattagcacgcaacctctagttgatggtagtcaa
tatggcagctacgtcaggggggagaataggaaagtctgggtcaacgaatcagatggagta
acaacattagttggagaggtgtggccaggggaagccgtgttcccagacttcaccaaccca
gagtgcaccagttggtgggtggaagaatgcagactgttttataacacagtgccatacgat
gggatctggattgatatgaacgaagtgtccaactttgttcaaggttcaagtaaaggctgc
gagcagaatgacttaaactatcctccattcactcccaatattgtcgataaactcatgttc
tccaagacactttgtatggatgcagtgcagaaatggggcaagcactacgatgtccacagt
ctttatggatattccatggccatagcaacaagacaagccatcgaaacagtgcttccagga
aaaagaagctaccttatttcaaggtctacttttattggatcaggaaagcacacaggacac
tggctgggagataatgcagcaacatgggaacagctaagatggtcaatacctgggatgctg
gaattcaacatctttggatttccttatattggagcagatatctgtggcttcgtttttgac
acgacagaagaactttgcagacgatggatgcaagtaggagcattttatccattttcccgg
aatcacaatgctgaagggtacatacatcaggatccagctgtgtttggagctgattcagtt
ttggtgcagacctccaagcactacctgagcattcggtacaccttgctgccctacttgtac
acgctgttttatagagctcatactcgaggggacacagttgtacgtccagttttgcatgag
ttctactctgatgaagggacgtgggcagttgataggcagttcctgtggggtcctgggcta
cttatttctgctgtaatggatcagggtgtggatataattgatgcatatattcctgatgca
gtatggtatgagtatgaaacaggggcaagaatctcagagagaaaacaatggaccaggatg
tacctgccagctgacaaactggggctccacttgagaggaggctatatttatcctattcaa
cagccagccactacaacagttgaaagccgccagaatccactgggacttataattgccctg
gatgagaacaatacagcttctggggagttattctgggatgatggagaatctacaggaaca
attgagagtaacaactacatttactacgagtttacagtttccaataaccgtctacaaatg
aatgtcataaacagtgtttatgttgatccaaacaacttaaaatttgaagaaattaaaatc
ctgggagtgctccaggaagtaacgactgttactgtctccctgaacaatgcagtgcaaact
tcttcacataatatcacctactaccctacagagaaggttgctcatataacagggcttcag
cttgaactgggaagatcttacacagtagaatggactcaacaacagagtatcaacgaaagg
tttgattgttatcctggcatagattcaacacgagaaaaatgtgaacaacttggctgtgtc
tgggatcaggcaccatcagacccgaatagtccatcctgctatttcagctctgacaacgtt
tattctgttggagaagtagaatactcttcatcaggtttggcagccaacctgaacttaagc
agtgccaataccagagctaatgacaattacactgcaccaattggtacgctacgcttggag
gttaaataccataccaacagcatgctgcaatttaagatttatgattaccagaatgcacga
tacgaggttcctatacaattaaacctcccaacctccccaacaagtacagctgagggacga
ctctatgacgtatcaattcagaaaaaaccatttggcatacaggttcgacgcaaaagcaca
gggacagttgtctgggattcacagctgcctaccttcacattcagcgacatgttcattcag
atctctacccgcttgccatcccagtatatatatggatttggagaaactgagcacaccacg
tatcgacgtaacatgaactggaacacctggggaatgttcacaagggatcagtctcctgct
gaccatttgaattcctatggtcatcatcccttttacatggctcttgaagaagatagcaat
gcccatggagttctcttgcttaacagcaatgcgatggatgtgactcttcagccaacccct
gccctgacataccgcaccattggaggaattcttgacttctacatggttttgggcccaaca
ccagagctcgttgttcaggagtacactgaactaattggacgaccagtgatgccaccttac
tggtccttgggattccaattgtgccgctatggatataggaatgattctgaagttgcccag
ctggtggaggagatgaaggcaactcaaattccctacgatgtccaatatgtagatattgac
catatggaacggcaactggatttcactcttagctcacgctttactgggttaccggctctt
gttaacaaaataaaaggagaaggaatgagatttatcattatactggatccaaccatctct
ggaaatgaaactaattatcctaccttctcaagaggtgtggataatgatgtcttcatgaag
tggccaaacagcaatgacattatatattccaaggtctggccgtttcttcccaatgttcaa
gtcaatgagtcactgcctgagcaaacccaaatacagctctttggagcacatgcagctttc
ccagacttcctccgcaattccacagtagagtggtggaagagagaaatcatggagttctac
aacaatcccactgatccctcaaaaagcatcaagttcgatggcctgtggattgacatgaat
gaaccggcaacttttatgaacgctgcatttggtggctgtagaaacgagatcctaaataac
ccaccgtatatgcctcatttgggataccggtcagaaggtttaacttacaaaagtccatgc
atggaaggtcagcaatacctcccagatggtaccccagttaggcactatgatgtccacagc
ctttatggatgggctcaaacaagacctaccctcgaagcattgcagagtgtcacaagggaa
cgtgggattgtcatcacccgttcaacatatcccagcagtggaagatgggcaggacattgg
ctgggtgataacgctgcagcttgggatcagttgtcaaagtctattattggtatgatggag
ttcagtctctttggaatatcatatacaggagctgatatctgtggcttctttaatgactca
gagtatgagttgtgtcttcgttggatgcagctgggttcattctacccatactcaaggaac
cacaatgagaaaggaacaaaaagacaggatcctgcttcctggaactcgacgtttgtggac
atttcccggcatgtgatgaatatcagatacactctgttgccctatttgtacaccttactg
catgaggcccatgtccatggcagtactgtggtccgccccgtgctccatgagtttgcacaa
gaaagagcaacctgggatatttttgagcaattcctctggggacctgccctgctcatcagc
cctgtaatggctccgggtgctgtaacagtgaatgcttacttacccaatgcccgctggtat
gattaccacacagatgaacatattaatgctaggggagaatacagagttttatcagctcct
ttggaacatatcaatcttcatatccgaggtggttacatcctggcttggcaagaacctgct
aatacaacctttttcagccggcaaaacccgatgggacttactgttgctttgaatgacagt
ctgcttgcagaaggacagctgtactgggatgatggggttcgcattgatgcatatgaaaat
ggtgcatacctgcttacgtcatttagtgctcagcagaatgctttagagatcaaggttgag
catcatggttacagtgatccgaacaacctgatgtttactgaaattaaagtcctgggtgtg
cccaccactgttcagcaggtgaacgtaacgcagaacggtgtgataattccatcagctcat
gtgctttcatatgacagcagcaagcaggtcatgaggatcatgcagcttcaacttcattta
ggacaaagctacacagtgcaatggagttaa

DBGET integrated database retrieval system