KEGG   Gallus gallus (chicken): 425060Help
Entry
425060            CDS       T01006                                 

Gene name
CLK2
Definition
CDC-like kinase 2 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     425060 (CLK2)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   425060 (CLK2)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    425060 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
25
AA seq 501 aa AA seqDB search
MPHSRRYRSSERSSRGSFHERYRSRKHKRRRSRSSSSERERRHRREGSYHVRSRSYDDHS
ADRRAYDRRYCDSYRRNDYSRERGEPYYDPEYRHSYEYRRSRDRDGSYRSCKSSRRKHRR
RRRRSRSFSRSSSRSRQSSRRAKSVEDDDEGHLIYRVGDWLQERYEILSTLGEGTFGRVV
QCMDHRRGGVRVALKIIKNVEKYKEAARLEINVLEKINEKDPENKNLCVRMFDWFDYHGH
MCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQVCQAVKFLHDNKLTHTDLKPENILF
VNSDYELTYNLEKKRDERSVKSTAIRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGW
SQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYHGR
LDWDENTSAGRYVRDNCKPLRRYLTSEAEDHHRLFDLIESMLEYEPSKRISLAEALKHPF
FDVLEMEPSTKMWDSSRDISR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcctcactccagaaggtaccgctcgtcggagcgcagcagccggggcagcttccatgag
cgttacaggagccgcaaacacaagaggcggcggtcgagatccagcagcagtgaacgtgaa
cggaggcaccgccgtgagggcagctaccacgtccgctccaggagctacgacgaccactca
gcagacaggagggcctacgaccgccgttactgtgacagctaccggcgcaacgattacagc
cgtgagcgaggagagccctactacgaccccgagtaccggcattcctacgagtaccggcgc
tcccgggaccgcgacggcagctaccggagctgcaaaagcagccggcgtaagcacaggcgg
aggcggcggcgcagccggtcctttagtcgctcctcatcgcggagtcgacagagcagcaga
agggccaagagtgtggaggacgacgacgaggggcatctgatctatcgcgtcggcgactgg
ctacaagaaagatatgagattctcagcactttaggggaaggcacgttcggcagagtggtg
cagtgcatggatcaccggaggggtggtgttcgtgttgctctcaaaatcattaaaaatgtg
gagaagtacaaggaggccgcccggctggagatcaacgtgctggagaaaatcaacgagaag
gatcctgagaacaagaatctctgtgtcaggatgtttgactggtttgactaccacggccac
atgtgcatctcctttgaactgctggggctcagcacttttgatttcctgaaggacaacaac
tatctgccttaccccatccaccaagtacggcacatggccttccaggtgtgccaggctgtg
aaatttctgcatgacaacaaactcactcacactgacctcaaacctgagaacatcctcttt
gtcaactctgactatgagctcacctataacctggaaaagaagcgggatgagcgcagtgtg
aagagcacggccatcagagtggtggattttggcagtgccacgtttgaccacgagcatcac
agcacaattgtgtctaccaggcactaccgggcccctgaggtcattctggagcttggctgg
agccagccctgtgatgtctggagcatcggctgcatcatctttgagtattatgtgggtttc
accctgttccagacacacgacaaccgggagcacttggccatgatggagaggatcttgggg
ccaattccttctcggatgatccggaagaccaggaagcagaagtatttctaccatggccgt
ttggactgggatgagaacacctctgctggccgttacgttagggacaactgcaagccgctg
cggcgctacctgacctccgaggctgaggaccaccaccgccttttcgacctcattgagagc
atgctggagtacgagccgtccaagcgcatcagcctggccgaagccctcaagcacccattc
tttgacgtgctggagatggagccgagcacaaagatgtgggactctagcagagacatcagc
cggtga

DBGET integrated database retrieval system