KEGG   Gallus gallus (chicken): 425119Help
Entry
425119            CDS       T01006                                 

Gene name
SUV420H1, CGI-85
Definition
suppressor of variegation 4-20 homolog 1 (Drosophila)
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    425119 (SUV420H1)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     425119 (SUV420H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
5
AA seq 880 aa AA seqDB search
MKWLGESKNMVVNGRRSGSRASNDHVQNQTKLQHTGKENPRSGKNGVERRSSRCSGASGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRALPSVSDCHYKSKSFSE
TSQMXFRPIKGRQEELKEVIERFKKDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEH
VFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENM
LLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGE
EISCYYGDGFFGENNEYCECYTCERRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRL
KKLGDSSKNSDSQSVSSNTDADTTQEKANATSNRKSSIGVKKNGKNRTLTRQSISRIPAS
SNSTSSKLTHINNSRVPKRLKKPAKPLLSKIKQRNQCKRPEQKNASKKLEMGNLVLKEPK
VVLYKSLPIKKDKELEGPVKVAVSSGCLTRHAAREYKLNSVKGAHEHGDIPPCTYITRRS
MRTRMSLKETSDIKLEPNTLDSYKNNLTRTRSDVLEQQPHATDENNLAHGTSHKGEARCQ
KNDAGTSKKKSRQGKLVKPPAKLDETDNTHNTPVKDEVPDLISSHSENGERNNVVDIPVS
YQDCISGSGSCSVVTSDSFKTKDSFRTAKXKKKRRITRYDAQLILENSSGIPKLTLRRRH
DSSSKANDQESDGMNSSKISIKLSKDHEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKRE
EENRGTYPEDLHENGVCCSETLSLLESRMEVDDYAQYEEETADESSSEEDDEEEDEYDDE
FDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggaggagtggaagcagg
gcatctaacgaccacgtgcagaatcaaaccaaattgcagcacacaggaaaggagaatccc
aggtctggcaaaaatggagttgagagaagatcaagcagatgtagtggtgcttcaggattt
gagggtcagagtcgttatgtgccttcctctggaatgtctgccaaggaactgtgtgaaaac
gatgacctagcaactagtttggttcttgatccttacttaggttttcagacacacaaaatg
aatactagagcacttccaagtgtttctgattgccattacaagagtaagtccttttctgaa
actagtcaaatgtaatttcgacctataaaaggaaggcaagaagaactaaaagaggtgatt
gaacgttttaagaaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgac
tgggcccggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaagaacat
gtatttatttatttacggatgtttgcaactgacagtgggtttgagatactgccttgtaat
cggtattcttctgagcagaatggagccaaaatagttgcaacgaaagaatggaaacggaat
gataaaatagaactacttgttggctgtattgctgaactatcagaaatggaagaaaacatg
ctgctgagacatggggaaaatgacttcagtgtaatgtattccacaaggaaaaactgtgca
caactgtggcttggtcctgctgcgtttatcaatcatgattgcagacctaactgtaagttt
gtgtcaactggcagagatacagcatgcgtgaaagctctgagagatattgaacctggagaa
gaaatctcttgttactatggagatggcttttttggagaaaataacgaatactgcgaatgt
tacacctgtgaaagacgtggaactggtgcttttaaatcaagagtgggattgccagcccct
actcctgtgattaatagtaaatatggactgagagaaacagataaacgattgaacaggctc
aaaaagctgggcgacagcagcaaaaactcagacagccagtccgtcagctctaacactgat
gcagataccactcaggaaaaagctaatgcaacttctaacagaaaatcttcaattggtgtg
aaaaagaatggcaaaaatagaacattaacaagacagtctatatcaagaattccagcatca
tcaaactctacctcatctaaactaactcatataaataattccagggtaccaaagagactg
aaaaagcctgcaaagcctttactttcaaagattaagcagagaaatcagtgcaaaaggcca
gagcaaaagaatgcttctaaaaagctcgaaatgggaaatttagttctcaaagagcctaaa
gtagttttgtacaaaagcttgcccattaaaaaggataaagaattagagggaccagtcaaa
gttgcagtctctagtggatgcttaacaaggcacgcagcaagagagtataaactgaattct
gtgaaaggtgctcatgagcatggtgacataccaccttgcacatacataacacggaggtca
atgagaacacggatgagtttgaaggagacctctgacataaagcttgaaccaaatacattg
gatagctataagaataacttgacgagaacacgatcggacgttttagagcagcagcctcac
gcaacagatgaaaacaacctggctcatggaacgtcacataaaggggaggccaggtgtcag
aaaaatgacgcaggcacgtcaaaaaagaagtctcgacaaggaaagctagtgaaaccacct
gcaaaattagatgaaacagataatacgcacaacacacctgtaaaagatgaagtaccagac
ttgatcagttctcactcagaaaatggagagaggaataatgtggtagatatacctgttagc
tatcaagactgtatctctggatctggtagctgttctgttgtaacctctgacagtttcaaa
acaaaggacagcttcagaactgcaaaanctaaaaagaaaagacgaatcacaaggtatgat
gcacaactaatccttgaaaatagctctgggatccctaaactgactcttcgtaggcgtcat
gatagcagtagcaaggcgaatgaccaagaatctgatggaatgaattcttcaaaaataagc
atcaaattaagtaaagaccatgaaaaggataataatttatatgtagcaaagctaaataat
gggtttaactcaggatcaggcaatagttcaacaaaactaaaaatacagttaaaacgagag
gaagaaaatagagggacgtaccctgaggaccttcatgaaaatggtgtgtgttgtagtgaa
actctctcccttttggagtcgagaatggaagtagatgattatgctcagtatgaggaggaa
acagcagatgaatcttcatcagaagaggatgatgaagaggaagatgaatatgatgatgaa
tttgatgactttattcctcttcctccagcaaagagactaaggcttattgttggcaaggat
tcgatagatattgatatttcttccaggaggagggaagatcagtctttaaggctcaatgca
taa

DBGET integrated database retrieval system