KEGG   Gallus gallus (chicken): 425119Help
Entry
425119            CDS       T01006                                 

Gene name
KMT5B, CGI-85, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    425119 (KMT5B)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     425119 (KMT5B)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     425119 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
5
AA seq 857 aa AA seqDB search
MKWLGESKNMVVNGRRSGSRASNDHVQNQTKLQHTGKENPRSGKNGVERRSSRCSGASGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIER
FKKDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRY
SSEQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQL
WLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYT
CERRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDAD
TTQEKANATNRKSSIGVKKNGKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKP
AKPLLSKIKQRNQCKRPEQKNASKKLEMGNLVLKEPKVVLYKSLPIKKDKELEGPVKVAV
SSGCLTRHAAREYKLNSVKGAHEHGDIPPCTYITRRSMRTRMSLKETSDIKLEPNTLDSY
KNNLTRTRSDVLEQQPHATDENNLAHGTSHKGEARCQKNDAGTSKKKSRQGKLVKPPAKL
DETDNTHNTPVKDEVPDLISSHSENGERNNVVDIPVSYQDCISGSGSCSVVTSDSFKTKD
SFRTAKTKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMNSSKISIKL
SKDHEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREEENRGTYPEDLHENGVCCSETLS
LLESRMEVDDYAQYEEETADESSSEEDDEEEDEYDDEFDDFIPLPPAKRLRLIVGKDSID
IDISSRRREDQSLRLNA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggaggagtggaagcagg
gcatctaacgaccacgtgcagaatcaaaccaaattgcagcacacaggaaaggagaatccc
aggtctggcaaaaatggagttgagagaagatcaagcagatgtagtggtgcttcaggattt
gagggtcagagtcgttatgtgccttcctctggaatgtctgccaaggaactgtgtgaaaac
gatgacctagcaactagtttggttcttgatccttacttaggttttcagacacacaaaatg
aatactagatttcgacctataaaaggaaggcaagaagaactaaaagaggtgattgaacgt
tttaagaaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcc
cggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaagaacatgtattt
atttatttacgaatgtttgcaactgacagtgggtttgagatactgccttgtaatcggtat
tcttctgagcagaatggagccaaaatagttgcaacgaaagaatggaaacggaatgataaa
atagaactacttgttggctgtattgctgaactatcagaaatggaagaaaacatgctgctg
agacatggggaaaatgacttcagtgtaatgtattccacaaggaaaaactgtgcacaactg
tggcttggtcctgctgcgtttatcaatcatgattgcagacctaactgtaagtttgtgtca
actggcagagatacagcatgcgtgaaagctctgagagatattgaacctggagaagaaatc
tcttgttactatggagatggcttttttggagaaaataacgaatactgcgaatgttacacc
tgtgaaagacgtggaactggtgcttttaaatcaagagtgggattgccagcccctactcct
gtgattaatagtaaatatggactgagagaaacagataaacgattgaacaggctcaaaaag
ctgggcgacagcagcaaaaactcagacagccagtccgtcagctctaacactgatgcagat
accactcaggaaaaagctaatgcaactaacagaaaatcttcaattggtgtgaaaaagaat
ggcaaaaatagaacattaacaagacagtctatatcaagaattccagcatcatcaaactct
acctcatctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcct
gcaaagcctttactttcaaagattaagcagagaaatcagtgcaaaaggccagagcaaaag
aatgcttctaaaaagctcgaaatgggaaatttagttctcaaagagcctaaagtagttttg
tacaaaagcttgcccattaaaaaggataaagaattagagggaccagtcaaagttgcagtc
tctagtggatgcttaacaaggcacgcagcaagagagtataaactgaattctgtgaaaggt
gctcatgagcatggtgatataccaccttgcacatacataacacggaggtcaatgagaaca
cggatgagtttgaaggagacctctgacataaagcttgaaccaaatacattggatagctat
aagaataacttgacgagaacacgatcggacgttttagagcagcagcctcacgcaacagat
gaaaacaacctggctcatggaacgtcacataaaggggaggccaggtgtcaaaaaaatgac
gcaggcacgtcaaaaaagaagtctcgacaaggaaagctagtgaaaccacctgcaaaatta
gatgaaacagataatacgcacaacacacctgtaaaagatgaagtaccagacttgatcagt
tctcactcagaaaatggagagaggaataatgtggtagatatacctgttagctatcaagac
tgtatctctggatctggtagctgttctgttgtaacctctgacagtttcaaaacaaaggac
agcttcagaactgcaaaaactaaaaagaaaagacgaatcacaaggtatgatgcacaacta
atccttgaaaatagctctgggatccctaaactgactcttcgtaggcgtcatgatagcagt
agcaaggcgaatgaccaagaatctgatggaatgaattcttcaaaaataagcatcaaatta
agtaaagaccatgaaaaggataataatttatatgtagcaaagctaaataatgggtttaac
tcaggatcaggcaatagttcaacaaaactaaaaatacagttaaaacgagaggaagaaaat
agagggacgtaccctgaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcc
cttttggagtcgagaatggaagtagatgattatgctcagtatgaggaggaaacagcagat
gaatcttcatcagaagaggatgatgaagaggaagatgaatatgatgatgaatttgatgac
tttattcctcttcctccagcaaagagactaaggcttattgttggcaaggattcgatagat
attgatatttcttccaggaggagggaagatcagtctttaaggctcaatgcataa

DBGET integrated database retrieval system