KEGG   Gallus gallus (chicken): 425530Help
Entry
425530            CDS       T01006                                 

Gene name
MYST2
Definition
MYST histone acetyltransferase 2 (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     425530 (MYST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
27
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDPEHTDSSESDATSRRSARVTRSSARLSQSSQDSSPVR
NPPSFGAEEPVYSTRRVTRSQQQPAPVTPKKYPLRQTRSSGSETEQVVDFSDRDTKNAAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSMKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLAHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLELFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKIMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcagaaagaggaatgcaggcagtagctcagatggaacagaagactctgatttc
tccacggatccggagcacacggacagctctgaaagcgacgccacatcgcggcggtccgcc
cgtgtgacccgctcctcagccaggctcagccagagctcccaagattccagcccggttcgc
aacccgccttcatttggagcagaagaacctgtttattccacgaggagggtgacccgcagc
cagcagcagcctgcccctgtgactccaaagaaatacccactccggcagacccgctcatct
ggatcagaaacggagcaagtggttgacttttctgacagagacactaaaaatgcagcggat
cacgatgagtctccacctcgtacccccaccgggaatgccccttcctcagagtctgatatt
gatatctccagtccaaatgtatcccatgatgagagcattgccaaggacatgtccatgaag
gattctggaagtgacctgtctcaccgccctaagcgtcgccgcttccatgaaagctacaat
ttcaacatgaaatgtcccactcctggttgtaactctttaggacacctaactggaaaacat
gagcgacacttctccatatcaggatgcccactgtatcacaatctgtcagcagatgagtgc
aaggtgcgagcacaaagccgggataaacagattgaggagagaatgctggcccatcggcag
gacgacaacaacaggcacgccaccaggcaccaggcaccaacagagagacagcttcgatac
aaagagaaagtagctgagctcaggaagaagaggaattcgggactaagcaaggagcaaaaa
gaaaaatacatggaacacaggcaaacctatggcaatactagggaacctctgcttgagaac
ctgaccagcgagtatgacctcgagctcttccgaagagcacaagcacgggcatctgaggac
ctggaaaagttgcggctccagggccagatcacagaaggcagcaatatgattaaaaccatc
gcttttggccgctatgaactggatacctggtatcattctccctacccagaggagtatgct
cgtctggggcgtctctacatgtgtgagttctgtctgaaatacatgaagagccagactata
ctgcgcagacacatggcaaaatgtgtttggaaacatccaccgggtgatgaaatctaccgc
aaaggctccatttcagtttttgaagtcgatgggaaaaagaacaagatctactgtcaaaac
ctatgtctgctggcaaagcttttcttggaccataaaacattgtattatgatgttgaaccc
ttcctcttctatgtcatgacagaagctgacaacactggctgccacctgataggatatttc
tctaaggagaagaattcttttctcaattacaatgtctcttgtatcctgacaatgccccag
tacatgaggcaaggctatggcaagatgctcattgacttcagctatttgctttctaaagta
gaagaaaaagttggatctccagagcgtcctctgtctgatttgggtctcatcagctaccgg
agttactggaaggaagttctccttcgttacctacataatttccaaggaaaagagatctct
ataaaagaaatcagccaggagactgcagtaaaccctgtcgacattgttagtacgttgcag
gcactgcagatgctgaagtactggaagggaaaacacctggtcctaaaaagacaggatctg
attgatgaatggatagccaaagaggcaaaaagatccaacagcaataagataatggatccc
agctgtttgaaatggacccctcctaagggaacttaa

DBGET integrated database retrieval system