KEGG   Gallus gallus (chicken): 425972Help
Entry
425972            CDS       T01006                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1 (EC:2.7.11.2)
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
7
AA seq 408 aa AA seqDB search
MRLLRALLRCASPGSIPQQVDFYSRFSPSPLSMKQFLDFGSENACEKTSFMFLRQELPVR
LANIMKEISLLPDNLLRTPSVQLVQSWYVQSLQEILDFKDKSSEDSGAIHSFTDTVIKIR
NRHNDVIPTMAQGVIEYKESFGIDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKI
NPAHPKHIGSIDPSCNVVGVIRDGYESAKSLCDLYYMSSPELVLEELNIKSPGQPMQVVY
VPSHLYHMVFELFKNAMRATMEHNADRCIYPPIHVHVTLGNEDLTVKMSDRGGGVPMRKI
DRLFNYMYSTAPRPRVETSRATPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIY
IKALSTESIERLPVYNKAAWKHYKANHEADDWCVPSSEPKDMTTFRST
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgcgcgccctgctgcgctgcgcctccccgggcagcatcccgcagcaggtg
gacttctactcgcgcttctccccctcgccgctctccatgaagcagttcctggacttcgga
tctgaaaatgcctgtgaaaagacttcatttatgtttctgcgacaagagctgcctgtaaga
ttagcaaacataatgaaggaaataagtctgcttccagacaatcttctcagaacaccttca
gttcagctggtgcagagttggtatgtccaaagtcttcaggagatccttgactttaaagac
aaaagttcggaagattcgggggctattcacagttttacagataccgtgataaaaatacgc
aatcgacacaacgatgtaattcctactatggctcaaggagtaatagagtacaaggaaagc
tttggcattgatccagtgacctcacagaatgtgcagtattttttagaccgtttctacatg
agtcgcatttcaattagaatgctccttaatcaacactctttactgtttggtgggaaaatt
aatccagctcatcctaaacacattggaagcattgatcctagctgcaatgttgttggagtt
attagagatggttatgaaagtgccaagagtctttgtgatttgtattatatgagctctcca
gaacttgtcctagaagagttgaatattaaatcaccaggacagcccatgcaagtggtgtat
gtgccgtcccacctctatcacatggttttcgaacttttcaagaatgcaatgagagccacc
atggaacataatgctgatcgatgcatttatcctccaattcatgtacatgtcaccttggga
aatgaggatttaactgttaagatgagtgatcgtggcggaggtgttcctatgaggaaaatt
gacagactattcaactatatgtattcaacagcaccacgtccacgtgttgagacatcccga
gctacacctttggctggatttggttatggcttgcccatatcacgcctgtacgcacaatac
ttccaaggcgacctgaaactgtattccttagaaggttatggcacagatgcagttatttac
atcaaggccttatcaacagaatcaatcgaaagactccctgtgtataataaagcagcctgg
aaacattataaagcaaaccatgaagcagatgactggtgtgtgccaagcagtgagccaaag
gacatgactacttttcgcagtacatag

DBGET integrated database retrieval system