KEGG   Gallus gallus (chicken): 426037Help
Entry
426037            CDS       T01006                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   426037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 118 aa AA seqDB search
MSAESGRMRGHPSSSGDKKSKRKPKRKETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVN
DIFERLAVEASRLAQYNHRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaaagtgggaggatgcgtggtcatccttcctcctctggtgacaagaagtcc
aagagaaagcctaagagaaaggaaacttattcagtctatatctacaaagtactgaagcag
gtgcaccctgacacaggtatctcctccaaggccatgagcatcatgaactcatttgtcaac
gacatctttgagcggctggcagtggaggcgtcgcgcctggcgcagtacaaccaccgctcg
accatcaccagccgggaggtgcagacggccgtgcggctcctgctgcccggagagctggcc
aagcatgctgtgtctgaaggcaccaaggctgtcaccaagtacaccagcagcaagtga

DBGET integrated database retrieval system