KEGG   Gallus gallus (chicken): 426044Help
Entry
426044            CDS       T01006                                 

Definition
alpha-2B adrenergic receptor-like
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
gga  Gallus gallus (chicken)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    426044
G protein-coupled receptors [BR:gga04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    426044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 378 aa AA seqDB search
MNTHPADTAQPEEPPLPPGPLPTHVRGISMEQQSAQEEWEAVEDIQSVLLGRSAGPVPLI
SFNEALQFFQTTDLSECRKKIQATVRRQGLTALLHFLFGPPRLQQQLQGERDLALAIAQC
ECSPSRPPSCSWWWLLSHYVPLVAAEGSRLLGVFPLPGGLDNNQAVHMRILQTIYKKLTC
SRLGCPRYGAHWEELGFQGADPGTDLRGTGMLGLMQMLYFVMDSQMLPLALEIFRLSQHE
TQNFPFCIMSVNITRLVLQALREECLSRECNRRQQVIAVLNDLYAAAFLQLYRVWKSQHK
TIADSGFLLKELEFSTKKNPKQLLKSLETYVSRSLVSTADGIQQASSLSISSGRAGEEIN
FMGICDLQVELEGEARLV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacccggcggacaccgcgcagcccgaggagcccccgctgccccctgggccc
cttcccacacatgtcaggggtatcagcatggagcagcagagtgcccaggaggagtgggag
gcagtggaggatatccagtcagtgctgctggggagatcagctggtcctgtgcccctcata
tccttcaatgaagcgctgcagttcttccagaccacagacctgtccgagtgcaggaagaag
atccaagcaacagtgcgcaggcagggcctgactgctctgcttcacttcctctttgggccc
ccccggctccagcagcagctgcagggcgagcgggacctggctctcgccattgctcagtgt
gagtgttccccctcacgtcccccaagctgcagctggtggtggttgctgtcccactacgtc
cccctggtggcagctgagggcagcaggctgctcggtgtctttcctctgccaggtggcttg
gataataaccaagcagtgcacatgagaatcctgcagaccatctacaagaagctgacctgc
tcccggctgggatgcccacgctacggtgcacactgggaggagctcggcttccaaggtgca
gatccagggaccgacctgcgagggacggggatgctgggcttgatgcaaatgctgtacttc
gtgatggactctcagatgctgcctctagctctagagatcttcaggctctcccagcatgag
acacagaatttccccttctgcatcatgtccgtgaacatcacccgcctcgtgctgcaggcc
ctgagggaggagtgtctctccagagagtgcaaccgcaggcagcaagtcatcgccgtgctg
aacgacctgtatgcagcggcgttcctgcagctctaccgagtctggaagtcacagcacaag
accatcgctgactctggcttcctcctgaaggagctggagttctccaccaaaaagaacccg
aagcagctcctgaagtccttggagacctacgtgagcagaagcctggtgtccacagcagat
ggcatccagcaagcatcctctctgtccatcagcagcggccgggctggtgaagagataaac
ttcatgggcatttgtgacctacaggttgagctggagggagaggcacggctggtctga

DBGET integrated database retrieval system