KEGG   Gallus gallus (chicken): 426223Help
Entry
426223            CDS       T01006                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gga  Gallus gallus (chicken)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    426223 (UROS)
Enzymes [BR:gga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     426223 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
6
AA seq 270 aa AA seqDB search
MKVLLLKDPKDKESGPDPYVKELGLYGFEATLIPVLSFEFVSLEGLFEKQLSHPECYGGL
VFTSPRALEAIKICLRENSKNEAWSKSLKQEWNAKPTYVVGKATASLVEEIGLCPQGEKS
GNAEKLAEYICSREGPHSSPLLFPCGALKREVLPTALKEKGIPLESLTVYQTAQHEHLQQ
SLSSYFSQQGVPASIVFFSPSGVKFCLQHIQKLSGDFANRIKFAAIGPTTAEAMEAAGIP
VSCTAESPTPQDLTAGIQKALRPQNCILSE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctgttactgaaggaccccaaagacaaagagtcaggaccggatccatacgtt
aaagaattaggattgtatggatttgaagcaactttgattccagttttgtcatttgagttt
gtatctcttgaaggcttgtttgaaaagcagctttctcatccagagtgttacggaggcctt
gtttttaccagtccaagagcattagaagccatcaagatatgtttaagagagaatagtaaa
aatgaagcatggtcaaaatctcttaaacaagaatggaatgccaaaccaacatacgtggta
ggaaaggctacagcttctcttgtggaagaaattggcctctgtccacaaggagaaaagagt
ggaaatgctgaaaaattagctgaatatatttgctcaagagagggacctcattcctcacct
cttctttttccttgcggagccctgaaaagagaagtacttcctacagcacttaaagaaaaa
ggcataccactggagagcctgactgtgtaccagactgcccaacacgagcatctccagcag
tcactgagcagctatttctcacagcagggagttccagccagcatcgtgttcttcagtcca
tctggtgtcaagttttgcctccagcacattcagaagctttctggtgattttgccaaccgc
ataaagtttgctgctattggtccaacaactgccgaagccatggaagcagcaggaatccca
gtgagctgcactgcagagagtcccactcctcaagacctcactgctggcatccaaaaagca
cttcgtccacagaactgcattttatctgagtga

DBGET integrated database retrieval system