KEGG   Gallus gallus (chicken): 426292Help
Entry
426292            CDS       T01006                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     426292 (MAPK15)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   426292 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 598 aa AA seqDB search
MRSLGLLAHALCVASVSTATEMSAMGEPEVDAAVAEKFEMKRRLGKGAYGIVWKAINRRT
GEIVAVKKIFDAFRNRTDAQRTFREIMFLQEFGEHPNIIKLLDVIRAQNNKDIYLVFESM
ETDLHAVIKKGNLLKDIHKCYILYQLLKATKFIHSGNVIHRDQKPSNILLDADCFVKLCD
FGLARSLCQMDEEQSSPALTEYVATRWYRAPEILLSSRSYTKGVDMWSIGCILGELLLGK
PLFPGTSTINQIEQILRVIPAPSSEDIMVMQSDYRASIIDHMSSRQRVTLEEILPSSTPL
PALDLLKKLLVFNPDKRLTAEEALQHPYVKRFHCPAREPSLGYDVILPLGDGTQLSVAEY
RNKLYEMILEKKVNSQPKEQMQRADTESSQSQPRPFFPHCNPVTLTTRKSHRVPTAPLLK
QPHTDAGSAANVQVEVFNQNEDFSTSLCQRSKITVIHNPITRSAAQSNANSGAVIRNHSA
PPPQQAKTASNGKERRQITWANANTQLLPTSVQNLYSNPRNTQFHSKDVHPLLKSSKKMF
HITANVGAAGDPKASMGSYSQAYGTICKSALQSLPISNSSQQHKEPIWKSSNQVSSAP
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcctcgggctgctcgcgcacgcgctgtgcgtcgcgtccgtttccacagcgacg
gagatgagcgccatgggcgaaccggaggttgacgcggccgtggcggagaagttcgaaatg
aagaggcgtctgggaaagggggcttacggcatcgtatggaaagcaattaatcgcaggaca
ggagaaattgtggcagtgaaaaagattttcgatgccttcaggaacagaacagatgctcag
agaacatttcgtgagattatgttcctgcaggagtttggagagcatccaaatatcatcaag
ctgcttgatgttatccgagctcagaacaacaaggacatctatctcgtttttgagtctatg
gagacagatttacatgctgtgattaagaaggggaatttactgaaagacatccacaagtgt
tacattctctatcaactcctgaaagccactaaattcatccattcaggaaatgttattcac
agggatcagaagccttcaaatatcttgctggatgcagactgctttgtgaagctctgtgat
tttgggctggcccgttctttgtgtcagatggatgaagaacaaagcagccctgccttaaca
gagtacgtggccacacgctggtaccgagcccctgagatcctgctttcctcccggagctac
actaaaggggtagacatgtggagcattggctgtattctgggtgagttgctacttggaaaa
cctctttttcctggaacatcaaccatcaatcaaatagagcagatcttgagggtcattcct
gccccatcctcagaagatattatggttatgcagtcagactacagggcctccattatcgac
cacatgagttcccggcaacgagtaacgttggaggagattttaccatcctctactcctttg
cctgccttggatcttctgaagaagcttttagtgtttaaccctgataaacggctgacagca
gaggaggcccttcagcatccgtatgtgaaaaggtttcactgccctgccagggagccctct
ctgggttacgatgtgattcttcctttaggtgatggtactcagctctctgtggcagaatac
cgaaacaaattatatgagatgatccttgaaaagaaagtaaacagccagccaaaggagcaa
atgcagagagcagacactgaatcaagtcagtctcaacccagaccattctttccacattgc
aatcctgtgactttaaccaccaggaaaagccacagagtgccaacagcacctctgctgaag
cagccacacacagatgctggaagtgcagccaatgtccaggtagaggtattcaaccagaat
gaagacttctcaacatctttatgtcagagatcaaagatcactgtgatacacaaccccata
acacgctctgctgctcaaagtaatgcaaattctggtgctgtgatcaggaaccattctgcc
ccacctcctcagcaggcaaaaaccgccagcaatgggaaggagaggagacaaattacgtgg
gcaaatgcaaatactcagctgcttcctacaagtgtacagaacctttacagtaatccacga
aatactcaatttcacagcaaagatgttcacccccttctgaaatccagtaagaagatgttc
catattactgccaatgtgggagctgctggcgatccgaaggcatcaatgggcagttactct
caggcctatggaactatatgcaaatctgcactgcagagccttcccatatcaaattcctcc
cagcaacacaaggagccaatatggaagagttcaaaccaggtctcatcagccccctaa

DBGET integrated database retrieval system