KEGG   Gallus gallus (chicken): 426504Help
Entry
426504            CDS       T01006                                 

Gene name
RP11-529K1.3, DDX19, DDX19B
Definition
(RefSeq) ATP-dependent RNA helicase DDX19B; Uncharacterized protein
  KO
K18655  
ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     426504 (RP11-529K1.3)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     426504 (RP11-529K1.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
21
AA seq 479 aa AA seqDB search
MATDSWALAVDEQEAAAESLSTLQLKEEKAKPDANGAVPKADDNVERTEDEEKEDRAAQS
LLNKLIRSNLVDTTNQVEVLQRDPNSPLYSVKSFEELHLKPQLLQGVYAMGFNRPSKIQE
NALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPGNKYPQCLCLSPTYELALQTGK
VIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFV
LDEADVMIATQGHQDQSIRIQRMLPRDCQMLLFSATFEDSVWKFAQKVVPDPNIIKLKRE
EETLDTIKQYYVLCNSRDEKFRALCNIYGAITIAQAMVFCHTRKTAGWLAAELSKEGHQV
ALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN
ETYLHRIGRTGRFGKRGLAINMVDSKHSMNILNRIQEHFSKKINKLDTDDLDEIEKITN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgactcgtgggccctggccgtggacgagcaggaggcggcggcggagtcgctg
agcaccctgcagctgaaggaggagaaggccaagcccgacgccaatggtgccgtgccgaag
gcggacgacaacgtggagaggacggaggatgaggagaaagaggaccgagctgcccagtcc
ctgctcaacaagctgatccgcagcaacttggtggacaccaccaaccaggtggaggtgctg
cagagggaccccaactcgccgctctactctgtcaagtccttcgaggagctgcacctgaaa
ccacagctcctgcaaggagtctatgccatgggcttcaacagaccatcaaagatacaggag
aacgccctgcccatgatgcttgctgaacccccgcagaacctgattgcacagtctcagtct
ggtactggcaagacggccgccttcgtcctcgccatgctcagccgtgtcgaacctgggaac
aagtacccacagtgcctgtgcctttccccaacatacgagctggcacttcagacaggaaaa
gtgatcgaacagatggggaagttttacccggagctgaagcttgcatatgctgtccgaggc
aataaattggagagaggtcagaagatctcagagcagattgtgattggcacacctggcact
gtgctggactggtgctccaagctgaagttcattgatcccaagaaaatcaaagtgttcgtc
ttggatgaggcggacgtgatgatagcaacccagggccatcaggatcagagcatccgcatt
cagagaatgctccccagggactgccagatgcttctgttctcagccacttttgaggattcc
gtgtggaaatttgctcaaaaagttgttcctgacccaaacatcatcaaactgaagcgagag
gaggagacactggacactattaagcagtattacgttctgtgcaatagcagagatgagaag
ttccgtgctctctgtaatatctacggcgctatcaccattgcccaggccatggtcttctgc
cacacccggaagacggctggctggctggcagcagagctctcgaaggaaggccaccaggtg
gcactgctcagcggggaaatgatggtggaacagagagccgcggtgattgagcgcttccga
gagggcaaggaaaaggtgctggtgaccaccaacgtctgtgccagagggatcgatgtggag
caggtctctgttgttatcaattttgaccttcctgtggacaaggatggaaatccagataac
gagacctacctgcaccgcatcgggcgcacggggcgcttcggcaagcgagggctggcgatc
aacatggtggacagcaagcacagcatgaatatcctcaacaggatccaggaacacttcagc
aaaaagatcaacaaattggatactgatgacttggacgaaattgagaagataactaactga

DBGET integrated database retrieval system