KEGG   Gallus gallus (chicken): 426864Help
Entry
426864            CDS       T01006                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 404 aa AA seqDB search
MGCRAPPGAMVLLLPLAVLLAVCRPGHGSSGACDTCGLRPMAYHYGGTRVVGGTDAPQGA
WPWIVSLQSTWYVGTGHICGGSLITPQWVLTAAHCFDHATPDTPWHVVIGGHDLKRLGPE
AVVRNVIRIIPHEYYHRNNMANDIALLELDQPVQCSYYIQLACVPDASLRVSELTDCYVS
GWGHMGLRSLQEYVEPYRVLQEAKVQLIDLNICNSSNWYAGAVHIHNVCAGYPQGGIDTC
QGDSGGPLMCKDKTADYFWLIGVTSWGKGCGRIQQPGVYASTQYFRNWILVQMGLLPAEA
PTTTPYPVYISTSYQRPKPTYSSPFRPCPFPRQKLLDFFNLLQELLQGLRGKKXLISCMT
QSRLQCIATLFFGVMPNGSPSTKALLCPIHPPLDCTPRFTQLDK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggctgccgtgcgcctccgggagcgatggtgctgctgctgcccctcgcggtgctgctg
gccgtctgccggcctgggcacggctcctccggcgcctgcgacacctgcgggctccggccc
atggcttatcactacgggggaacgcgtgtcgtgggcggcacggacgccccgcagggggcc
tggccgtggattgtcagcctccaaagcacgtggtatgtgggcacgggacacatctgtgga
ggatctctcatcaccccgcagtgggtcctcacggcagcgcactgcttcgaccatgcaacc
cccgacacgccgtggcacgtggtgatcggtggccacgatctgaaacgcctgggccccgaa
gctgtcgtgcgcaacgtgatacggataatcccccacgaatactatcacagaaacaacatg
gccaatgacatcgcgctgcttgagctggaccaacctgtccagtgcagctactacatccag
ctcgcctgcgtgcccgatgcctcgctgcgagtgtcagagctcacagactgctatgtcagt
ggctggggacacatggggctgagatctctacaggaatatgtcgaaccataccgtgtcctg
caggaggccaaggtccagctcattgacctcaacatctgcaacagcagcaactggtatgct
ggggctgtccatatccacaacgtgtgtgctggttacccgcagggcggcatcgacacctgc
cagggtgacagcggtggtcctctcatgtgcaaagataaaactgctgactacttctggctc
attggtgtgaccagctgggggaaaggctgtgggagaatacagcagcctggagtctatgcc
tccactcagtactttcgcaactggatcctggtacagatgggattgcttccagcagaagcg
cctactacaacgccatatccagtctatatctcaacctcctaccagaggccaaaaccaaca
tactcgagcccatttagaccatgcccatttccacgccagaagctcctggatttctttaat
ctgctccaggagctcctgcagggtttaagaggaaagaaangcttaattagctgcatgacc
cagagcaggctgcaatgcattgcgacccttttctttggggtaatgcccaatggcagcccc
agtaccaaagccctgctctgtcccatccaccctcctcttgactgcacacccaggtttact
cagttggacaaataa

DBGET integrated database retrieval system