KEGG   Gallus gallus (chicken): 426970Help
Entry
426970            CDS       T01006                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9, apoptosis-related cysteine peptidase
  KO
K04399  
caspase 9 [EC:3.4.22.62]
Organism
gga  Gallus gallus (chicken)
Pathway
p53 signaling pathway
VEGF signaling pathway
Influenza A
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    426970 (CASP9)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    426970 (CASP9)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    426970 (CASP9)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     426970 (CASP9)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     426970 (CASP9)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C14: caspase family
   426970 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
21
AA seq 418 aa AA seqDB search
MEEAQRSALRRGRVRLVEGLRPEVLWGPLQARGVFTSAMVEDMQSTGTRREQARQLVIDL
ETRGKQAFPIFLSILRDTGHGDLADMLDEGCGSPMSPPVDLRPVQLELPGERRDKSVSTA
ERLSIPVQPESERFRMPPAPAQGSAVDKSDHRLVYQLRADPCGHCLIFNNVSFSRDSDLS
TRAGSDIDCEKLEKRFRSLCFHVRTLRNLKAQEIDVELRKLARLDHSALDCCLVVILSHG
CQTSHIQFPGGIYGTDGKIIPIERIVNYFNGSQCPSLRGKPKLFFIQACGGEQKDQGFEV
DCESPQDETCRRSIESDAIPFQAPSGNEDEPDAVASLPTPGDILVSYSTFPGFVSWRDKV
SGSWYVETLDSVLEHYARSEDLLTMLLRVSDIVSTKGRYKQIPGCFNFLRKKFFFLCK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcgcagcggagcgctctgcggcgcggccgggtgcggctggtggaggggctg
cggccggaggtgctctgggggccgctgcaggcccgaggggttttcaccagcgctatggtg
gaggacatgcagagcaccggcacccgaagggagcaagcacgacagctggttattgacctg
gagacccgtgggaagcaggccttcccaatattcctctccatcctgagggacaccgggcac
ggtgacctggctgacatgctggatgagggctgcggaagcccgatgtccccacctgtggac
ctgaggcctgtgcagctggagctgcctggagaaaggcgtgacaaaagtgtgagcactgcg
gaacgcttgtccatcccagtccaacctgagagtgagcgatttcggatgcctccggcacca
gcccagggttcagctgttgacaagagcgaccacagactggtgtaccagctgcgagcagac
ccttgtgggcactgcctgatcttcaacaatgtcagcttcagcagagactctgatctgtcg
actcgagctggctctgacatagactgtgagaagctggagaagcgtttcaggtccctgtgc
ttccacgtccggaccctgcggaacctcaaagctcaggaaattgatgtggagctgcggaag
ctggcgcggctcgaccacagtgccctggactgctgcctcgtggtcatcctctcccatggt
tgccagacaagccatattcagtttcccggagggatttatggaacagatggcaaaatcatt
ccaatcgaaaggattgtgaactatttcaatgggtcccagtgcccgagtttgagaggaaaa
cccaaactcttcttcatccaggcctgtggaggagaacaaaaggaccaaggatttgaggtg
gattgtgaatcaccccaagatgaaacttgccgacgttccatagagtcggatgcgattcct
ttccaggctccatcagggaatgaggacgagccagacgccgtcgccagtttgcccactcct
ggtgacatcttggtgtcctattcaacttttccaggttttgtgtcctggagggacaaggtg
agtggctcgtggtacgtggaaaccttggacagcgtactggaacattacgcccgttctgaa
gacctgctaaccatgctacttcgggtgtcagacatcgtatccaccaaggggaggtacaag
cagatcccgggctgtttcaacttcctacgtaaaaaattcttcttcctgtgcaagtga

DBGET integrated database retrieval system