KEGG   Gallus gallus (chicken): 426970Help
Entry
426970            CDS       T01006                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9, apoptosis-related cysteine peptidase
  KO
K04399  
caspase 9 [EC:3.4.22.62]
Organism
gga  Gallus gallus (chicken)
Pathway
p53 signaling pathway
Apoptosis
VEGF signaling pathway
Influenza A
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    426970 (CASP9)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    426970 (CASP9)
   04115 p53 signaling pathway
    426970 (CASP9)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    426970 (CASP9)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     426970 (CASP9)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     426970 (CASP9)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C14: caspase family
   426970 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
21
AA seq 418 aa AA seqDB search
MEEAQRSALRRGRVRLVEGLRPEVLWGPLQARGVFTSAMVEDMQSTGTRREQARQLVIDL
ETRGKQAFPIFLSILRDTGHGDLADMLDEGCGSPMSPPVDLRPVQLELPGERRDKSVSTA
ERLSIPVQPESERFRMPPAPAQGSAVDKSDHRLVYQLRADPCGHCLIFNNVSFSRDSDLS
TRAGSDIDCEKLEKRFRSLCFHVRTLRNLKAQEIDVELRKLARLDHSALDCCLVVILSHG
CQTSHIQFPGGIYGTDGKIIPIERIVNYFNGSQCPSLRGKPKLFFIQACGGEQKDQGFEV
DCESPQDETCRRSIESDAIPFQAPSGNEDEPDAVASLPTPGDILVSYSTFPGFVSWRDKV
SGSWYVETLDSVLEHYARSEDLLTMLLRVSDIVSTKGRYKQIPGCFNFLRKKFFFLCK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcgcagcggagcgctctgcggcgcggccgggtgcggctggtggaggggctg
cggccggaggtgctctgggggccgctgcaggcccgaggggttttcaccagcgctatggtg
gaggacatgcagagcaccggcacccgaagggagcaagcacgacagctggttattgacctg
gagacccgtgggaagcaggccttcccaatattcctctccatcctgagggacaccgggcac
ggtgacctggctgacatgctggatgagggctgcggaagcccgatgtccccacctgtggac
ctgaggcctgtgcagctggagctgcctggagaaaggcgtgacaaaagtgtgagcactgcg
gaacgcttgtccatcccagtccaacctgagagtgagcgatttcggatgcctccggcacca
gcccagggttcagctgttgacaagagcgaccacagactggtgtaccagctgcgagcagac
ccttgtgggcactgcctgatcttcaacaatgtcagcttcagcagagactctgatctgtcg
actcgagctggctctgacatagactgtgagaagctggagaagcgtttcaggtccctgtgc
ttccacgtccggaccctgcggaacctcaaagctcaggaaattgatgtggagctgcggaag
ctggcgcggctcgaccacagtgccctggactgctgcctcgtggtcatcctctcccatggt
tgccagacaagccatattcagtttcccggagggatttatggaacagatggcaaaatcatt
ccaatcgaaaggattgtgaactatttcaatgggtcccagtgcccgagtttgagaggaaaa
cccaaactcttcttcatccaggcctgtggaggagaacaaaaggaccaaggatttgaggtg
gattgtgaatcaccccaagatgaaacttgccgacgttccatagagtcggatgcgattcct
ttccaggctccatcagggaatgaggacgagccagacgccgtcgccagtttgcccactcct
ggtgacatcttggtgtcctattcaacttttccaggttttgtgtcctggagggacaaggtg
agtggctcgtggtacgtggaaaccttggacagcgtactggaacattacgcccgttctgaa
gacctgctaaccatgctacttcgggtgtcagacatcgtatccaccaaggggaggtacaag
cagatcccgggctgtttcaacttcctacgtaaaaaattcttcttcctgtgcaagtga

DBGET integrated database retrieval system