KEGG   Gallus gallus (chicken): 427185Help
Entry
427185            CDS       T01006                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit (EC:2.7.1.-)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    427185 (PRKAA1)
   04150 mTOR signaling pathway
    427185 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    427185 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    427185 (PRKAA1)
   04920 Adipocytokine signaling pathway
    427185 (PRKAA1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     427185 (PRKAA1)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   427185 (PRKAA1)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    427185 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    427185 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 560 aa AA seqDB search
MRRLSCWFKMAAADKQKHEHGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILN
RQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKN
GRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGE
FLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICD
GIFYTPQYLNPSVISLLKHMLQVDPMKRATIRDIREHEWFKQDLPKYLFPEDPSYSSTMI
DDEALKEVCEKFECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPD
SFLDDHHLSRPHPERVPFLVAEAPRPRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPND
IMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSAYSKMSLQLYQVDSRTYLLDFRSIDD
EIIETKSGTATPQRSGSVSNYRSCQKDSDGDAQGKSADTSLTSSMTSSLDSSTADLTPRP
GSHTIEFFEMCANLIKILAQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagctgttggttcaagatggcggcggcagataaacagaagcacgagcac
gggcgagtgaagattgggcattacattctgggcgacacgcttggcgtcggcactttcggc
aaagttaaggttggcaagcatgagttaactggacataaagttgcagtgaagatcctgaat
cgacaaaagattcgcagccttgacgttgtaggaaaaattcgcagggagattcagaacctc
aaactcttcagacatcctcatataattaagctgtaccaggtcatcagtaccccaactgac
attttcatggtgatggaatacgtttctggaggagagctgtttgattatatctgtaaaaat
ggaaggcttgatgagaaggaaagtagacgtctgttccagcaaatcctttctggtgtggat
tactgtcacaggcacatggtagttcacagagatctaaagcctgaaaatgtgttgcttgat
gcacacatgaatgccaagatagctgactttggtctatcaaatatgatgtctgatggagaa
tttttaagaacaagctgtggttcccctaactatgctgcaccggaagtaatttcaggaagg
ttatatgcaggcccagaagtagatatttggagcagtggggttattctctatgcactgtta
tgtggaacacttccatttgatgatgatcacgtgccaacactttttaagaagatatgtgat
ggtatcttttatacccctcagtacctgaatccatctgtcattagtcttctgaaacatatg
ctgcaagtggatccaatgaagagagcaacaatccgagacattagggaacacgaatggttt
aagcaggaccttcccaaatacttgtttcctgaagacccttcgtatagttctaccatgatt
gatgacgaagccttaaaagaagtatgtgagaagtttgaatgtaccgaagaggaagtgtta
agttgtctgtatagccgaaatcatcaggatcctttagcagttgcttatcacctcattata
gataatagaagaataatgaacgaggccaaagacttctacctggctacaagcccgccagat
tcttttcttgacgatcaccatctgtctcgccctcatcctgagagagtgccattcttagta
gctgaagcaccacggcctcgccatactcttgatgagctgaatccacagaaatcaaaacac
caaggtgtaagaagagcgaagtggcatttggggatacggagtcagagtcgaccgaatgat
ataatggctgaagtttgtcgagcaattaagcagctggattatgaatggaaggttgtaaat
ccatactacttgcgtgttcgacggaagaatccagtgacaagtgcatattctaaaatgagt
ttacaactgtatcaagtggacagcagaacatatttactagacttccgtagcattgatgat
gaaatcattgaaacgaagtctgggactgcaactccacagagatcaggttctgtgagcaat
tacagatcctgtcagaaagattcagatggtgatgcacaaggaaaatctgcagatacatcc
cttacctcatcaatgacctcttcacttgattcttcgacagctgacttaactccaagacca
ggcagtcatacaatagaattttttgagatgtgtgcaaatcttattaaaatacttgcacaa
taa

DBGET integrated database retrieval system