KEGG   Gallus gallus (chicken): 427204Help
Entry
427204            CDS       T01006                                 

Gene name
HEXB
Definition
hexosaminidase B (beta polypeptide)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gga  Gallus gallus (chicken)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    427204 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    427204 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo series
    427204 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    427204 (HEXB)
   00511 Other glycan degradation
    427204 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    427204 (HEXB)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     427204 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
Z
AA seq 558 aa AA seqDB search
MGRAMGVAGLLVGLLLVPAVLLGGSFGRGEPPPDPQPALSEWETASDAVPEDSLWPLPQS
IRTSRLRLQLAPERFQVVHGAGSSAGPACGLLQDAFRRYFEYMFGRSRWRKPYRASPSAQ
GELSQLQVVIASSEPGCDSFPHLASNEAYHLTVTEPVAILKADEVWGALRGLETFSQLVH
EDDYGSFLINESEIYDFPRFAHRGILLDTSRHYLPLKSILTNLDAMAFNKFNVLHWHIVD
DQSFPYQSISFPELSNKGAYSYNHVYTPTDVHLVIEYARLRGIRVIPEFDTPGHTQSWGK
GQKDLLTPCYSGERPSGSFGPVNPILNSTYDFMATLFKEISSVFPDAYIHLGGDEVSFDC
WKSNPEVKEFMKKQGFGTDYAKLESYYIQKILDIVSSYNKGYMVWQEVFDNKAELKPDTV
VEVWMANNYAHELSSVTKAGFTAILAAPWYLDYISYGQDWTKYYRVEPLNFPGSEKQKKL
LIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSRNVTNLQDAYKRLTNHRCRMLSRG
IAAEPLFVGYCPHEARWR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagccatgggggtagccgggctgctcgtgggattgctcctcgtgcccgccgtg
ctgctcggcggcagcttcggccgcggagagccgccccccgatccgcagccggcgctgtcc
gagtgggagacggcgtcggacgccgtccctgaggactcgctgtggccgctgccgcagtcg
atccgcacgtcccgtctccggctgcagctggcccccgagcgcttccaagtggtgcacggc
gccggctcctcggcggggccggcctgcggactcctgcaggacgccttccgcaggtatttc
gagtacatgttcgggcgctcgcgctggaggaagccgtaccgagcgtcgccgtccgcgcaa
ggggagctgtcgcagttgcaggtggtgatcgcctcctcggagcccggctgtgacagcttc
ccgcacctcgcgtccaacgaggcctatcatttaactgtaactgagcctgtggctatactg
aaagcagatgaggtatggggagctttaagaggtttggaaactttcagtcagttggttcat
gaagatgattatggaagttttcttatcaatgaatccgaaatctatgacttcccgaggttt
gcacacagaggaatcttacttgacacttcaaggcactatttgccattgaaatctattctc
acaaacctggatgccatggcttttaacaagttcaatgttctccactggcatatagtagat
gatcagtcatttccttaccagagtatttcttttcctgagcttagtaacaagggggcttac
tcttacaaccatgtctatactcctactgacgtccatctggtgatcgagtatgcccgatta
agaggcattagagttatcccagagtttgataccccaggacacacacagtcttggggaaaa
ggtcagaaagatcttctcaccccatgttacagtggagaacggccaagtgggtcctttgga
cctgtaaatcccattttgaattcaacttatgacttcatggctacattattcaaagaaatc
agcagtgtatttcctgatgcctacatccacctgggaggagatgaagtgagcttcgattgt
tggaaatctaaccctgaagtgaaagagttcatgaagaagcaaggatttggcactgactat
gctaaactggaatcatactatattcagaagattttggatattgtttcctcctataacaaa
ggatacatggtctggcaggaagtatttgataacaaagcagagctgaaaccagacactgta
gttgaagtgtggatggcaaataactacgctcacgaactgagcagtgtcactaaagcaggg
tttactgctatcctggcagctccctggtatttggactacattagttatggacaagactgg
acaaaatactaccgtgttgaaccacttaacttccctggatctgaaaaacagaaaaagctc
ttaataggtggagaagcttgcctgtggggagaatacgtggatgcaactaacctcacacca
agactctggcctcgggcaagtgctgtaggggaaagactttggagcagcagaaatgtgacc
aacttgcaggatgcctataaaagactgactaaccaccgatgccgcatgctcagcagaggc
atagcagctgagcctctttttgttggctattgtccccatgaagcaagatggcggtga

DBGET integrated database retrieval system