KEGG   Gallus gallus (chicken): 427272Help
Entry
427272            CDS       T01006                                 

Gene name
SYK
Definition
spleen tyrosine kinase (EC:2.7.10.2)
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 613 aa AA seqDB search
MASNMANPANHLPYFFGNITREEAEEYLMQGGMSDGLYLLRQSRNYLGGFALSLAYGRKV
HHYTIERELSGTYAIAGGKSHASPAELINYHSEEADGLICLLRKSFNRPPGVEPKTGPFE
DLKENLIREYVKQTWNLQGHALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREESEHR
ILIGSRNDGKFLIRERDSNGSYALCLLNDGKVLHYRIDRDKTGKLSIPDGKRFDTLWQLV
EHYSYKPDGLLRVLSIPCPRHGSESDNVVFDTRPLPGTPSKLQTPIGAPSDDQTPFNPYV
LQRARGLIGAEKGDQREALPMDTEVYESPYADPDEIKPKNVTLDRKLLTLEEGELGSGNF
GTVKKGFYKMKKGAKPVAVKILKNESNDPAIKDELLRGANVMQQLDNPYIVRMIGICEAE
AWMLVMEMAELGPLNKFLQKNRHVTEKNITELVHQVSMGMKYLEENNFVHRDLAARNVLL
VTQHYAKISDFGLSKALSADENYYKAQSHGKWPVKWYAPECMNFYKFSSKSDVWSFGVLM
WEAFSYGQKPYKGMKGGEVAQMIERGERMECPEACPVEVYDLMKLCWTYNVDDRPGFVAV
ELRLRNYYYDISH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacatggccaaccctgctaaccatttgccatacttctttggcaatattaca
cgtgaggaagctgaggagtatttgatgcaaggaggaatgagcgatggactatacctgctt
cgccaaagccggaattacctagggggctttgccttgtccttggcctatggaaggaaggtt
catcattacacaattgagagagagctgagtgggacatatgctattgcaggaggcaaatca
catgcaagtcctgctgaactcattaactatcattcagaagaagcagatggccttatctgt
ctactgagaaaatctttcaatcgaccgccaggcgttgagcccaaaacagggccctttgaa
gatttaaaagagaacctcatcagagagtatgtcaagcaaacgtggaatctgcagggtcat
gctcttgaacaagctatcattagccaaaaacctcagctggagaaactgattgctactaca
gcccatgagaagatgccttggttccatgggaggatctctcgggaagagtcagagcaccgt
atcctcattgggtcaagaaacgacggaaaatttttaatacgagaaagggacagcaatggt
tcctatgccctgtgtttgctcaatgatggaaaagtactgcattaccgtattgacagagat
aagacaggaaagctctccataccagatggaaaaagatttgacaccctctggcagttagtt
gagcattattcttacaaaccggatggattattaagggttctgtccattccctgtccacgg
catggctcagaaagtgataatgttgtttttgacactcgtcctctccctggaaccccttct
aagctccagacacctattggtgccccatctgatgaccaaacaccttttaatccttatgta
ctgcaaagagcaagaggtctaataggagcagagaaaggtgatcagagagaggccttaccc
atggacactgaggtttatgaaagtccatatgctgatccagatgaaattaaaccaaaaaat
gtcactctcgacaggaaattgttaaccctggaggaaggagaacttggctctggaaacttt
ggtactgtaaagaaagggttctataagatgaaaaagggggccaagccagtggctgtaaaa
attcttaagaacgagagcaatgatccagccataaaggatgagttactgagaggagcaaat
gtaatgcagcaactggacaatccatatattgtccgaatgataggtatatgtgaagcagag
gcctggatgttagtaatggaaatggctgaacttgggccactgaacaagtttttgcaaaaa
aataggcacgtcacagaaaagaatataacagagctggtacatcaggtttccatgggaatg
aaatatctggaggagaataactttgtacatagggatctggctgcaaggaacgtgctatta
gtcacccagcattatgccaaaatcagtgacttcggactatctaaggctcttagtgctgat
gaaaattattacaaggcacaaagtcatggaaaatggccagtcaagtggtatgctccagaa
tgtatgaatttctacaagttttccagcaaaagtgatgtctggagctttggagttttaatg
tgggaagctttctcttatgggcaaaagccctataaaggaatgaaaggtggtgaagttgca
cagatgattgaaagaggagaacgaatggaatgtcctgaagcctgtccagtggaagtctat
gacttaatgaaattatgttggacatacaatgttgatgaccgaccaggattcgttgccgtg
gagctgcgattacggaactactattacgacatttcccactaa

DBGET integrated database retrieval system