KEGG   Gallus gallus (chicken): 427272Help
Entry
427272            CDS       T01006                                 

Gene name
SYK
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    427272 (SYK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     427272 (SYK)
Protein kinases [BR:gga01001]
 Non-receptor tyrosine kinases
  SYK family
   427272 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 427272
NCBI-ProteinID: NP_001026601
CGNC: 53036
Ensembl: ENSGALG00000015216
UniProt: F1N9Y5
Position
Z
AA seq 613 aa AA seqDB search
MASNMANPANHLPYFFGNITREEAEEYLMQGGMSDGLYLLRQSRNYLGGFALSLAYGRKV
HHYTIERELSGTYAIAGGKSHASPAELINYHSEEADGLICLLRKSFNRPPGVEPKTGPFE
DLKENLIREYVKQTWNLQGHALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREESEHR
ILIGSRNDGKFLIRERDSNGSYALCLLNDGKVLHYRIDRDKTGKLSIPDGKRFDTLWQLV
EHYSYKPDGLLRVLSIPCPRHGSESDNVVFDTRPLPGTPSKLQTPIGAPSDDQTPFNPYV
LQRARGLIGAEKGDQREALPMDTEVYESPYADPDEIKPKNVTLDRKLLTLEEGELGSGNF
GTVKKGFYKMKKGAKPVAVKILKNESNDPAIKDELLRGANVMQQLDNPYIVRMIGICEAE
AWMLVMEMAELGPLNKFLQKNRHVTEKNITELVHQVSMGMKYLEENNFVHRDLAARNVLL
VTQHYAKISDFGLSKALSADENYYKAQSHGKWPVKWYAPECMNFYKFSSKSDVWSFGVLM
WEAFSYGQKPYKGMKGGEVAQMIERGERMECPEACPVEVYDLMKLCWTYNVDDRPGFVAV
ELRLRNYYYDISH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacatggccaaccctgctaaccatttgccatacttctttggcaatattaca
cgtgaggaagctgaggagtatttgatgcaaggaggaatgagcgatggactatacctgctt
cgccaaagccggaattacctagggggctttgccttgtccttggcctatggaaggaaggtt
catcattacacaattgagagagagctgagtgggacatatgctattgcaggaggcaaatca
catgcaagtcctgctgaactcattaactatcattcagaagaagcagatggccttatctgt
ctactgagaaaatctttcaatcgaccgccaggcgttgagcccaaaacagggccctttgaa
gatttaaaagagaacctcatcagagagtatgtcaagcaaacgtggaatctgcagggtcat
gctcttgaacaagctatcattagccaaaaacctcagctggagaaactgattgctactaca
gcccatgagaagatgccttggttccatgggaggatctctcgggaagagtcagagcaccgt
atcctcattgggtcaagaaacgacggaaaatttttaatacgagaaagggacagcaatggt
tcctatgccctgtgtttgctcaatgatggaaaagtactgcattaccgtattgacagagat
aagacaggaaagctctccataccagatggaaaaagatttgacaccctctggcagttagtt
gagcattattcttacaaaccggatggattattaagggttctgtccattccctgtccacgg
catggctcagaaagtgataatgttgtttttgacactcgtcctctccctggaaccccttct
aagctccagacacctattggtgccccatctgatgaccaaacaccttttaatccttatgta
ctgcaaagagcaagaggtctaataggagcagagaaaggtgatcagagagaggccttaccc
atggacactgaggtttatgaaagtccatatgctgatccagatgaaattaaaccaaaaaat
gtcactctcgacaggaaattgttaaccctggaggaaggagaacttggctctggaaacttt
ggtactgtaaagaaagggttctataagatgaaaaagggggccaagccagtggctgtaaaa
attcttaagaacgagagcaatgatccagccataaaggatgagttactgagaggagcaaat
gtaatgcagcaactggacaatccatatattgtccgaatgataggtatatgtgaagcagag
gcctggatgttagtaatggaaatggctgaacttgggccactgaacaagtttttgcaaaaa
aataggcacgtcacagaaaagaatataacagagctggtacatcaggtttccatgggaatg
aaatatctggaggagaataactttgtacatagggatctggctgcaaggaacgtgctatta
gtcacccagcattatgccaaaatcagtgacttcggactatctaaggctcttagtgctgat
gaaaattattacaaggcacaaagtcatggaaaatggccagtcaagtggtatgctccagaa
tgtatgaatttctacaagttttccagcaaaagtgatgtctggagctttggagttttaatg
tgggaagctttctcttatgggcaaaagccctataaaggaatgaaaggtggtgaagttgca
cagatgattgaaagaggagaacgaatggaatgtcctgaagcctgtccagtggaagtctat
gacttaatgaaattatgttggacatacaatgttgatgaccgaccaggattcgttgccgtg
gagctgcgattacggaactactattacgacatttcccactaa

DBGET integrated database retrieval system