KEGG   Gallus gallus (chicken): 427325Help
Entry
427325            CDS       T01006                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
gga  Gallus gallus (chicken)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    427325 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 343 aa AA seqDB search
MEKTLIRIHPVSDPEAVYFLQVSWEKDVSSGFGIILTDGERAWTGTVSEAEISREAADME
MNREKYVEELKKALILGEESAGKYNFTVSVDEENAQCHFSYERNLRDGSFRLGSLKLQKV
PCPADVVRELIGYCLDCLGGLQVKNEHLQKENERLFCDLSDVEKRLEKCVEAKEELEGDL
YNRFVLVLNEKKMKIRNLQKLLNEAKESAVDTHCARDSIATTQMATEKENDYDGSTEEES
ENLIQSSLPSAPERRDSLLGSPDVIGTAPRRKRRQRTVNSAGTEAKIATYETEMLAKENC
QLPNGRTKNTTCTPVPFSILPRDVKFTLLMFCSFLSKASCNPT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaactttgatcagaattcatccagtttctgatccagaagcagtgtattttctg
caagtatcatgggaaaaagatgtaagcagtggctttggtataatacttaccgatggtgaa
cgtgcatggaccgggacagtgtctgaagctgaaatttctagggaggctgctgacatggaa
atgaatagagagaaatatgttgaagaactgaagaaagcattgatacttggagaagaatca
gctggcaaatacaacttcactgtttcagtggatgaagaaaatgcacagtgtcacttctcc
tatgaaagaaatctgagagatggctcttttagacttggatctctgaagctacagaaagtt
ccgtgtccagctgatgtggttagagagctgattggctattgtctggactgcttaggagga
ctccaggtgaaaaatgagcacctgcaaaaagaaaatgagaggcttttctgtgatttgagt
gatgttgagaaaaggctggaaaaatgtgtagaagctaaagaagaactagagggagatctt
tataatcggtttgttttggtgctgaatgaaaagaagatgaagataagaaacttgcagaag
ttgttgaacgaagctaaagaatctgcagtggatacccactgtgcaagggatagtatagct
acaacacagatggcaacagagaaagaaaatgactatgatggcagcactgaggaggaaagt
gaaaatttaatacagtcctcattaccatcagcaccagaacgaagagattccctactgggt
agtcctgatgtcatcggtactgctccaagacgaaagagaagacaaagaacagtaaattct
gctgggacagaagctaagatagcaacttatgaaacagaaatgctagcaaaggaaaactgc
cagcttccaaatgggaggacaaagaacactacttgcactcctgttcctttcagcatcctt
ccaagagatgtaaagtttactcttttaatgttttgtagtttcctttctaaagcttcctgt
aacccaacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system