KEGG   Gallus gallus (chicken): 427328Help
Entry
427328            CDS       T01006                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  
cyclin H
Organism
gga  Gallus gallus (chicken)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    427328 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    427328 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    427328 (CCNH)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     427328 (CCNH)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     427328 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
Z
AA seq 322 aa AA seqDB search
MFYSSTQRRYWTFRSEDELARSRADANRKFRSKAVAGGKVHQGDSFLLEAHEELAICKYY
EKRLLDFCAVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSAQFVGNLRESPVGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGILIDLKTRYPL
LENPEVLRKTADDFLSRVALTDAYLLFTPSQIALAAILSSASRAGINMESYLSECFMLKE
NRTFLAKLLEGMKSMKNLIKKYELPRPEEVASLKQKLEKCHSPELSLNTNVKKRKIGEED
EYSSKKPKMDEEEWTDEDFGDL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttctacagcagcacgcagcggcggtactggaccttccgcagcgaggatgagctggcg
cggagccgtgccgatgccaaccgaaagtttcgcagcaaagcggttgccggcgggaaggtg
caccagggtgactctttcctgctggaggcccacgaggagttggcgatatgcaagtactac
gagaagaggctgctggatttctgtgccgtgttcaagcctgccatgccgcggtctgtagtg
ggaacggcttgcatgtatttcaaacgtttttatctcaataactcagtgatggagtatcac
cctcggataataatgctaacatgtgcatttttagcctgtaaagtagatgagtttaatgtg
tccagcgctcagtttgttggtaaccttcgagaaagccctgttggacaagaaaaagctctt
gaacagatactggaatatgaactcctacttattcagcagttgaacttccatcttattgta
cacaatccgtacaggccatttgagggaattctaattgatttgaagactcggtacccactg
ctggaaaatcctgaagttttaaggaaaacagctgatgacttcctcagccgagtggctctg
acagacgcgtatctgctcttcactccctcacagattgctcttgctgctatactatccagt
gcttcaagagcaggaattaatatggaaagttatttatcagaatgttttatgctgaaagaa
aacagaacgttcttggccaaactactggagggcatgaaaagcatgaaaaatcttataaag
aagtatgaacttccaaggcctgaagaggttgcatctctaaaacagaagttagagaagtgt
cacagcccggagctttcgcttaacactaacgtgaagaagaggaaaattggtgaagaagat
gaatatagctcaaaaaagcctaaaatggatgaggaagaatggactgatgaagactttggg
gacttgtga

DBGET integrated database retrieval system