KEGG   Gallus gallus (chicken): 427328Help
Entry
427328            CDS       T01006                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
gga  Gallus gallus (chicken)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    427328 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    427328 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    427328 (CCNH)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     427328 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
Z
AA seq 356 aa AA seqDB search
MFYSSTQRRYWTFRSEDELARSRADANRKFRSKAVAGGKVRRGAGAGWAASAGPLGERGG
AGPGLFRSASFPQVHQGDSFLLEAHEELAICKYYEKRLLDFCAVFKPAMPRSVVGTACMY
FKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSAQFVGNLRESPVGQEKALEQILEY
ELLLIQQLNFHLIVHNPYRPFEGILIDLKTRYPLLENPEVLRKTADDFLSRVALTDAYLL
FTPSQIALAAILSSASRAGINMESYLSECFMLKENRTFLAKLLEGMKSMKNLIKKYELPR
PEEVASLKQKLEKCHSPELSLNTNVKKRKIGEEDEYSSKKPKMDEEEWTDEDFGDL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttctacagcagcacgcagcggcggtactggaccttccgcagcgaggatgagctggcg
cggagccgtgccgatgccaaccgaaagtttcgcagcaaagcggttgccggcgggaaggtg
cggcgcggggcgggggcgggttgggccgcctctgcggggccactgggggagaggggcggc
gccgggccgggcctcttcaggtcggcgtctttcccccaggtgcaccagggtgactctttc
ctgctggaggcccacgaggagttggcgatatgcaagtactacgagaagaggctgctggat
ttctgtgccgtgttcaagcctgccatgccgcggtctgtagtgggaacggcttgcatgtat
ttcaaacgtttttatctcaataactcagtgatggagtatcaccctcggataataatgcta
acatgtgcatttttagcctgtaaagtagatgagtttaatgtgtccagcgctcagtttgtt
ggtaaccttcgagaaagccctgttggacaagaaaaagctcttgaacagatactggaatat
gaactcctacttattcagcagttgaacttccatcttattgtacacaatccgtacaggcca
tttgagggaattctaattgatttgaagactcggtacccactgctggaaaatcctgaagtt
ttaaggaaaacagctgatgacttcctcagccgagtggctctgacagacgcgtatctgctc
ttcactccctcacagattgctcttgctgctatactatccagtgcttcaagagcaggaatt
aatatggaaagttatttatcagaatgttttatgctgaaagaaaacagaacgttcttggcc
aaactactggagggcatgaaaagcatgaaaaatcttataaagaagtatgaacttccaagg
cctgaagaggttgcatctctaaaacagaagttagagaagtgtcacagcccggagctttcg
cttaacactaacgtgaagaagaggaaaattggtgaagaagatgaatatagctcaaaaaag
cctaaaatggatgaggaagaatggactgatgaagactttggggacttgtga

DBGET integrated database retrieval system