KEGG   Gallus gallus (chicken): 427638Help
Entry
427638            CDS       T01006                                 

Gene name
GPX3
Definition
glutathione peroxidase 3 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    427638 (GPX3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    427638 (GPX3)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     427638 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
13
AA seq 219 aa AA seqDB search
MGCRAACVLAVLLAGLVPLGQGQEREKVKCYDSVRGTIYDYGALTIDGDEYIPFRKYAGK
MVLFVNVATYUGLTLQYLELNALQNELGPYGLVVLGFPSNQFGKQEPGQNSEILPALKYV
RPGGGFVPNFQLFQKGDVNGAKEQKVYSFLKNSCPPVAEEFGNPKNLFWEPLRNHDIKWN
FEKFLVGTDGVPVMRWYHRANIATVKNDIIAYMRQQRGQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggggtgccgagccgcctgcgtgctggccgtgctgctggccgggctcgtcccgctgggg
cagggccaggagagggagaaggtgaaatgctacgactccgtgcggggcaccatctacgac
tacggggcgctgaccatcgatggggacgagtacatccccttccgaaagtacgcggggaag
atggtgctctttgtcaacgtggccacgtactgagggctcaccctgcagtacctcgaactg
aatgcactacaaaatgagctggggccctatggacttgtcgtcctgggcttcccctccaac
caatttgggaagcaggagcctggccagaactccgagatcctccctgcactgaagtacgtg
cggccaggaggtggcttcgtccccaacttccagctcttccagaaaggggatgtgaacggg
gccaaggagcagaaggtctacagcttcctgaagaactcctgccctccggtggcagaggag
ttcggcaaccccaagaacctcttctgggagccgctgaggaaccacgacatcaaatggaac
tttgagaagttcctggtgggcactgacggggtgcccgtcatgcgttggtaccaccgcgcc
aacatcgccactgtcaagaacgacatcatcgcctacatgcggcagcagcggggccagtag

DBGET integrated database retrieval system