KEGG   Gallus gallus (chicken): 427687Help
Entry
427687            CDS       T01006                                 

Gene name
PLCB1
Definition
phospholipase C, beta 1 (phosphoinositide-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    427687 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    427687 (PLCB1)
   04020 Calcium signaling pathway
    427687 (PLCB1)
   04070 Phosphatidylinositol signaling system
    427687 (PLCB1)
 Cellular Processes
  Cell communication
   04540 Gap junction
    427687 (PLCB1)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    427687 (PLCB1)
   04916 Melanogenesis
    427687 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    427687 (PLCB1)
   04270 Vascular smooth muscle contraction
    427687 (PLCB1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     427687 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
3
AA seq 1214 aa AA seqDB search
PGVHALQLKPFCVSDTLKKGIKFVKWDDDSTVVTPIILRTDPQGFFFYWTDQNKETELLD
ISLVKDARCGKHARAPKDPKLRELLDAGNVGSRLENRMITVVYGPDLVNISYLNLVAFQE
DIAKEWSDEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKR
VETALEACNLPSSRNDSIPQDDFTPDVYRVFLNNLCPRPEIDHIFSEFGAKSKPYLTVDQ
MMEFINLKQRDPRLNEILYPPLKQEQVQQLIEKYEPNSNLAKKGQISVDGFMRYLSGEEN
GVVPPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDC
WKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKM
AEYCRLIFGDALLMDPLEKYPLEPGVPLPSPMDLMYKILVKNKKKSHKSADGSAKKKLSE
QASNTCSDTSSMFEPSSPGAGEAEIESDDDDDYDDDCKKSSMDEGTAGSEAMATEEMSNL
VNYIQPVKFESFEVSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTR
VDSSNYMPQVFWNAGCQMVALNFQTVDLSMQINMGMYEYNGKSGYRLKPEFMRRPDKHFD
PFTESIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKALKTKTSQGNAV
NPVWEEETIVFKKVVLPTLACLRLAVYEEGGKFIGHRILPVSAIRPGYHYICLRNERNQP
LTLPALFVYIEVKDYVPDTFADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEVD
HGDAPSEANSEPRPTPAENGVNHTASLTSKPTTQVVHSQPTPGLVKAPAKTEDLIQSVLT
EVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTAKYNEIQNDYLRRR
AVLEKTAKRDSKKRSETGSPDHGSSTIEQELASLDSEMTQKLVELKEKQQQQLLNLRQEQ
YYSEKYQKREHIKLLIQKLTDVAEECQNSQLKKLKETCEKEKKELKKKMDKKRQEKITEA
KSKDKNQMEEEKTEMIRSYIQEVVQYIKRLEDAQSKRQEKLIEKHKEIRQQILDEKPKLQ
VELDQEYQDKFKRLPLEILEFVQEAMKGKISEDGDHSSAPSSLASDSGKSNHKPLQSEEE
LEEDNSEKVFDTTF
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
ccaggggtgcacgctttgcagctcaagcccttctgcgtctccgacacgctgaagaaaggc
atcaaattcgtcaagtgggacgatgactcaactgttgtgactccaattatactcagaacg
gatccacagggatttttcttctactggacagatcaaaacaaggagacagagctgctcgat
atcagtcttgtcaaagatgccagatgtggaaaacatgccagagctcccaaggatccaaag
ctgcgtgagctgctggatgctgggaacgttggaagtcggcttgaaaatcgaatgataact
gttgtctatggaccagacctggtcaatatatcgtacttgaacttggtggcgtttcaagag
gatatagcgaaggaatggtcagatgaagtgttcagtttggcaacaaatttgttggcacag
aacatgtcaagggacgcatttctggaaaaagcctacacaaaacttaaactacaggtgact
ccagaaggacgcattcctctgaagaacatataccgcttgttttctgctgacagaaaacgt
gtagagacagcattagaagcttgtaatcttccatcttccaggaatgattcaatccctcaa
gatgacttcacgcccgacgtgtacagagtgttcttaaacaacctctgccctcgacctgaa
atcgaccacatcttttccgagtttggtgccaagagtaaaccataccttactgttgatcag
atgatggaatttataaatcttaagcaacgtgatccacgattaaatgaaatcctttatcca
ccattaaaacaggaacaagttcaacaactgattgagaaatatgaacccaacagtaaccta
gcgaagaaaggacagatatcagtggatggatttatgcgatatctgagtggagaagaaaat
ggcgttgttccacctgagaaactggatttaaatgaagatatgtctcaaccactgtcacac
tatttcatcaattcctcacacaacacctacctcacagctggacagctggccgggaactct
tcggtggagatgtatcggcaagtgcttctgtcaggctgccgctgtgtggagctggactgc
tggaaagggcgaacagctgaagaagagccggtcattacgcacggcttcactatgacaact
gaaatatctttcaaggaagtaatagaagctattgctgagtgtgcatttaagacatcgccc
tttccaatcctcctttcctttgaaaatcatgtggattcccctaagcaacaggcaaaaatg
gcagagtactgcagattaatatttggagatgcattgcttatggatccactggagaagtac
ccgcttgaacctggggttcctcttccaagccctatggatttaatgtacaaaattctggtg
aaaaataaaaagaagtcacataagtctgcagatggaagtgccaagaagaagctctcagag
caagcttccaacacgtgcagtgatacatctagtatgtttgagccttcctccccaggagca
ggagaagcagagattgagagtgatgatgatgatgactacgatgatgattgtaaaaagtcg
tcgatggatgaaggtactgctggaagtgaggctatggccacagaagagatgtctaacctg
gtgaactacattcagcctgtgaaatttgagtcatttgaggtatcaaaaaaacgcaacaaa
agttttgaaatgtcttcctttgtggaaaccaaagggcttgagcaacttaccaagtctcct
gtggaatttgtggaatacaacaaaatgcagctaagccgaatttacccaaaaggaacacgt
gtagattcttcaaactacatgccacaagtcttttggaatgctggctgccaaatggttgct
ctcaacttccaaactgtagatttgtctatgcaaataaacatgggaatgtatgagtacaat
ggcaaaagtggatacaggttaaagccagaattcatgagaagaccagacaaacactttgat
ccatttactgagagcattgtggatggaatcgtagctaacaccttgtctgtgaagattatt
tcaggccagtttctttctgataaaaaagttggtacctatgtagaagttgacatgtttggc
ctgcctgtggatacaagaagaaaagctttaaagaccaagacctcgcaaggcaatgcagtt
aatcctgtctgggaagaggaaactatagtgttcaagaaggttgttttacctaccctggca
tgtttgaggctagcagtgtatgaggaaggagggaaatttattggtcatcggatattacca
gtctcagcaattcgaccaggctaccactacatctgtttgaggaatgagaggaaccaacct
ttgacactgccagctctctttgtgtacattgaggtcaaagactatgtgcctgatactttc
gcagatgtgatcgaggccttatccaatccaatcagatatgtaaacttgatggagcagaga
gctaagcaactggcagcactgactctggaagatgaagaagaggtaaagaaagaggtggac
cacggagatgcaccatctgaagctaacagtgaacctaggccaacaccagcagaaaatgga
gtaaatcacactgcctctcttacatcgaaaccaacaactcaggttgtccatagccaacca
acaccaggtttggtgaaagcacccgcgaagaccgaagatcttattcagagtgtcctcaca
gaagtggaagcgcagactattgaagagctaaaacaacagaagtcatttgttaagcttcag
aagaagcactacaaagaaatgaaggaccttgttaaaaggcaccacaagaaaaccactgat
cttatcaaagagcacactgcaaagtataatgaaatccaaaatgactatctgcgacgaaga
gcagttttagaaaaaacagcaaaaagagacagtaagaaaagatctgaaacaggcagccca
gaccatggttcatcaactattgaacaagaactggcttcccttgactctgaaatgacccag
aagctagttgagttgaaggaaaagcaacagcagcagctgctaaacctccgacaggagcag
tattacagtgaaaagtaccagaagcgagagcacattaagctgcttattcagaagttgaca
gatgtagcagaggaatgtcagaacagccagctaaagaaactgaaagaaacgtgtgaaaaa
gaaaagaaagaattgaagaaaaaaatggacaagaagaggcaggagaagatcacagaagca
aaatccaaggataaaaatcaaatggaagaagagaagactgaaatgattcgatcgtatatc
caggaggtggtgcaatacataaaaaggctagaggatgctcagagtaaaagacaggagaaa
ctgatagaaaaacacaaggagatccgtcagcaaatactggatgaaaagcccaagttgcag
gtggaacttgatcaggaatatcaagacaaattcaaaagactgcctttggaaattctggag
tttgtacaggaagccatgaaagggaaaatcagtgaagatggagaccacagttctgccccc
tcttctctggcatctgacagtgggaaatcaaatcataaacctctgcaaagtgaagaggaa
ctggaagaagataattcagaaaaagtgtttgatactactttttaa

DBGET integrated database retrieval system