KEGG   Gallus gallus (chicken): 427774Help
Entry
427774            CDS       T01006                                 

Gene name
PNPLA7
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    427774 (PNPLA7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     427774 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
17
AA seq 1324 aa AA seqDB search
MEEEGNGTSLEAMPASGILQFVEDRIQSTMLTGIAIGAAVALFLIGIVVFVIYRRVKQSK
QLQPHGPQYRFRKRDKVMFYGRKIMRKVSTLPNTLVGNTVPRQRMRKRAKVLNLAKRILR
IKKECPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKH
MFFVQLHEGEYIFRPGQLDNSIYVVQDGKLEVCVQESDGTEVIVKEVLAGDSVHSLLSIL
DVITGHPAPYKTVSARAATPSNILRLPASAFQDVFQKYPETLVRVVQIIMVRLQRVTFLA
LHNYLGLTTELFNCQNQAIPLVSVASVTSGGSSSKAAKRQVSSVSEEERGEKFEKSGEAS
EMDTLKNSGTENPEHIFRRSLSSPPSTETSGTSSGAKSDMDMAYERARVHFSSEEASCSP
VVGKSILKKTVTVTRTPSVVFRYTDCELTAQESCNGKPTDAIFEAAKKDLSTLMKLDDPS
LLNDRVTLHQVTAGTVLSRQGDQDVNVCFVVSGMLHVYQQKVDSEEDTCLFITHPGELVG
QLAVLTGEPLIFTIKANRDCSFLSISKSHFYEIMREQPSVVLGVAHTVVKRMSSFVRQID
FALDWMEVEAGRAVYRQGDKSDCTYIVLNGRLRSVIRMDDGKKHLTGEYGRGDLIGVVEA
LTHQPRATTVHAVRDSELAKLPEGALTSIKRKFPQVVTRLIHLLGEKILGSLQQGGHPFG
LHSPSSKWDAGNPASNLSTIAIMPVSEEVPLTAFTLELKHALSAVGPALLLTSDNIKQRL
GSAALDSIHEYRLTSWLGQQEDIHRIVLYQADSTLTPWTQRCIRQADCILIVGLGDQEPT
VGELERMLENTAVRAQKQLILLHKEDGPLPSRTVEWLNMRSWCSAHLHLHCPRRVFSKRS
LPKLIEMYERVFQKPPDRHSDFSRLARVLTGNAIALVLGGGGARGCSQVGLIRALIEAGI
PVDMIGGTSIGAFMSALYAEERSYNQMRIKARQWAMVMNSVFKTILDLTYPITSMFSGAA
FNNSISNIFKDKQIEDLWIPYFTITTDITASAMRVHTDGSLWRYIRASMSLSGYMPPLCD
PKDGHLLMDGGYVNNLPADVARSMGAKVVIAIDVGSRDETNLTNYGDCLSGWWLLWKRWN
PLAEKVKVPNMAEIQTRLAYVCCVRQLEMVKSSDYCEYIRPPIDRYGTLDFGKFDEICEV
GYQHGKTVFGVWSRSGVLDKMLRDRQETHKTKTSDNVTYPSTSFTDLAEIVSRIEPVKAA
VADDESDYQTEYEEEVLDNQKDDYIHFIGNQAEDDSDSDEDVQIRKRKNLPKVDCQASST
GEPA
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaggcaacggcaccagccttgaggccatgccagcaagtggaattcttcag
tttgtagaagacagaatacagagtactatgctgactggaattgccattggagctgcagtt
gcactgttcctgataggaattgttgtgtttgtcatttacagaagagtgaaacaatccaaa
caacttcagccacatggtcctcaatacagatttcgcaagagagacaaagtgatgttctat
gggcggaagatcatgagaaaggtttcgactcttccgaacactctggttgggaacactgtg
cctcgccaaaggatgagaaaacgggccaaagttttaaatttggctaaaaggattctgcgt
attaagaaagaatgtccaactctgcagccaaaagagccacctccctctctactagaggca
gatctgacagaatttgatgtaaagaattctcatttgccgtcggaagtcctatacatgctt
aaaaatgttagggttcttggtcactttgagaagcctctttttctggaattgtgcaagcac
atgttttttgtgcagttgcatgaaggagaatacatcttccgtcctgggcagctggataac
agcatctatgttgtgcaagatggaaagctggaagtttgcgttcaagaaagtgatggcaca
gaagtgattgttaaggaggtgctggcaggagacagtgtccacagtcttctcagcattcta
gatgtcatcacgggtcaccctgctccatacaaaacagtctcagcccgggcagccactcca
tccaatatactgcgacttccagcaagtgcctttcaagatgtcttccagaaataccctgaa
actcttgttagagtggtgcagatcatcatggtgaggctgcagagagtgacattccttgcc
ttgcacaactaccttgggctgactactgagctcttcaattgtcagaaccaagccatccca
ctggtctctgtggcaagtgtcacatctggaggaagttcaagtaaagcagcaaaaagacaa
gtgtccagtgtatcagaggaggagcgtggagagaagtttgagaaatctggggaagcatca
gaaatggatacattgaagaattctggtacagaaaaccctgagcatattttcaggagaagc
ctttcttcacccccttctacagagacttctggtacttccagcggtgcgaagtcagacatg
gacatggcatatgagagagccagagtgcacttcagctcagaagaggcttcttgcagtcct
gttgtgggcaagtcgatattgaagaagactgtgacagtgacaagaaccccttcagtagtt
ttccgttacactgattgtgagctgactgcacaggaatcctgtaatggcaaacccaccgat
gccatcttcgaagcagcgaagaaagacctttcaaccctgatgaaacttgatgatccttcc
ctgctgaatgacagagtgacactgcatcaggttactgctgggactgtgctgtcaaggcag
ggagatcaggatgttaatgtttgctttgtggtctccgggatgcttcacgtgtaccaacag
aaggtcgactccgaggaggacacctgcctgttcattactcacccaggagaactcgtgggc
cagcttgctgttctcactggggaaccactgattttcaccatcaaggccaatcgagactgt
agcttcctgtctatttccaagtcccacttctacgagataatgcgagagcagccaagtgtt
gtgcttggtgtggcccacactgttgtaaagagaatgtcctcatttgtgaggcaaattgac
tttgccctggattggatggaagttgaggctggacgagctgtatacaggcagggtgacaag
tcagattgcacatacatcgtcttgaatggacgactgcgctcagtcatacggatggatgat
gggaagaagcacctgactggtgaatatggccgaggagacttaattggagtggtagaggca
ctaacccatcagcctagagccacaacagttcatgccgtcagagattcagaacttgccaaa
ctcccagagggagccctgacatctatcaaacgcaaattcccccaggttgtgactaggctt
attcacttgctgggcgagaagatccttggcagccttcagcagggaggccatccttttgga
ttgcacagcccaagcagcaaatgggatgccggaaatcctgccagcaatctctccacaata
gcaattatgccggtgtctgaagaggtgccactcactgctttcactctggagctcaagcat
gctcttagtgctgtgggtcctgccttgctgctcacaagtgataacatcaaacagcggctg
ggttctgctgcactggacagtatccatgagtaccgcctgacgagctggctgggccagcag
gaggacatccaccgcatcgtcctgtaccaggcagacagcacccttactccgtggactcaa
cgctgcatcaggcaggctgactgcatcttgatagtgggactgggagaccaggagcccact
gttggagagctggagaggatgctggagaacacagcggtccgagcccagaagcagctgatt
ctgctccataaggaggatggacctctcccttcccgaactgtggaatggctcaatatgagg
agctggtgttctgctcatcttcatctccactgtccacgaagagtgttttccaaaagaagc
ttgccaaagctgatagagatgtatgaacgtgtgttccagaagccaccagaccgccactcg
gacttctctcgcctggctcgtgtcctgactggaaatgccattgccctggtccttggtggt
gggggagccagggggtgctcccaggtcgggcttatcagggcgctgattgaagctggcatc
cccgtggatatgattggaggaacgtccatcggcgctttcatgagcgctctgtacgcagaa
gaacgcagctacaatcagatgaggatcaaagccaggcagtgggccatggttatgaattca
gtgtttaagactattctagacttgacgtatccaataacctcaatgttttctggagcagct
tttaacaacagcatcagcaacatcttcaaggataagcagattgaggatctgtggattcct
tacttcacaatcacaactgacatcactgcctcagcaatgagggtccacaccgatggctct
ctgtggaggtacatccgtgccagcatgtctctctctgggtacatgcccccgctctgcgac
ccaaaggatgggcacctcctgatggatggaggttatgtcaacaacctgcctgctgatgtg
gcgaggtccatgggtgcaaaggtggtgatagcaatcgatgtggggagccgggatgagacc
aacctcaccaactacggtgactgcttgtccggctggtggctgctgtggaagaggtggaat
ccactggctgagaaagtcaaggtgccgaacatggcagagatccaaacacggctcgcgtac
gtgtgctgcgtgcggcagctggagatggtgaagagcagcgactactgcgagtacatccgg
ccacccatcgaccgctacggcacgctggattttgggaagtttgatgagatctgtgaagtg
ggatatcaacatgggaagactgtgtttggtgtctggtccaggagcggcgtccttgacaag
atgctacgagacagacaagagacacacaaaaccaaaacttctgataacgtgacctatccc
agcacctccttcacagacctggcagaaatcgtgtccaggatcgagccagtgaaagctgcc
gtggctgatgatgagtcagactaccagactgagtatgaggaagaagttctggacaaccag
aaggatgattatattcatttcatagggaaccaggctgaagacgactctgactcggatgaa
gatgtacagataagaaagcgcaagaatctcccaaaggtggactgccaggcaagcagcaca
ggagagccagcctag

DBGET integrated database retrieval system