KEGG   Gallus gallus (chicken): 427803Help
Entry
427803            CDS       T01006                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00600  Sphingolipid metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04370  VEGF signaling pathway
gga04371  Apelin signaling pathway
Module
gga_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    427803 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    427803 (SPHK1)
   04371 Apelin signaling pathway
    427803 (SPHK1)
   04020 Calcium signaling pathway
    427803 (SPHK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     427803 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 427803
NCBI-ProteinID: XP_004946176
CGNC: 16472
Ensembl: ENSGALG00000023541
Position
18
AA seq 462 aa AA seqDB search
MQPLGSSERRKNRFIRQQQLPWHPFLPPRRYRRPLRGGKEEERSPPAAPRRCVRETAAGK
WWKRCRSPASGGERGDGAATLGFHCSGVSYGLLPRPCRALVLLNPQSGAGRALEDFQAVV
QPMLADADIAATVFVTERPHHAQEKVRDEDLSQWDVLVVMSGDGLLHEVLNGLMERPDWE
EALQTPLCILPGGSGNALAASINYYAGNDHVAKKKLLTNCTFILCKGLHAPMDLVSLSTA
SGKRFFSFLGFGWGFIADVDIDSEKYRRLGNARFTLGTLQCLVRLRVYQGRLSYLPAATE
PGTPRDRKAPARRAAPTAGTEAPSGHGALPADTLLVPLGQPVPPHWVVVPEEEFVCVYAI
YQSHLGTNLLMAPAARLHDGCIHLFYVGAGISRVALLKIFLAMGRGTHLDLNCPHLHCVP
VRAFRLEPRGSAGIMTVDGEALACEPVQGQIHGHMCRVVTAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccttgggagctcggaaaggaggaaaaacagatttataaggcaacagcagctt
ccgtggcatccttttcttcctccccgccgctatcgccgccccctaaggggtgggaaggag
gaggagaggagccctcctgccgccccgcggcgctgcgtgagggaaaccgctgctgggaag
tggtggaagcgctgccgcagccctgcatctgggggagagcggggagatggagcggccaca
cttggattccattgctccggtgtcagctatgggctgctgccccggccctgccgagctctg
gtgctgctgaacccgcagagcggcgctggccgcgcccttgaggacttccaggcggtggtg
cagcccatgctggctgatgcagacatcgcagccaccgtctttgtcaccgagagaccccac
cacgctcaggagaaggtgcgggatgaagacctgtcgcagtgggatgtgctggtggtgatg
tctggggatggtctgctccacgaggtgctgaatgggctgatggagcggccggactgggag
gaggccctgcagacaccgctgtgcatcctgcccgggggctccgggaatgccctggctgcc
tccatcaactactatgcgggcaacgaccacgtggccaagaagaaactgctgaccaactgc
accttcatcctgtgcaaagggctgcacgccccgatggacctggtctcgttgagcacagcc
tcgggcaaacgcttcttctccttcctgggcttcggatggggtttcatcgccgacgtggac
atcgacagcgagaagtaccggcggctgggcaacgcgcgcttcacgctgggcacgctgcag
tgcttggtgcgcctgcgcgtctaccagggccgcctctcctacctgcctgcggccaccgag
ccgggcacccccagggaccgcaaggcgcccgcccggcgggccgcaccaacagcggggacg
gaggcgccgagcgggcacggggcgctgcccgctgacacgctgctggtgccgctggggcag
ccggtgccgccgcattgggtggtggtgcccgaggaggagttcgtctgcgtctacgccatc
taccagtcccacctgggcaccaacctgctgatggccccggcggcgcggctgcacgacggc
tgcatccacctcttctacgtgggggcgggcatcagccgcgtggcgctgctgaagatcttc
ctggccatgggcaggggcacgcacctggatctgaactgcccccacctgcactgcgtcccg
gtgcgcgccttccgcctggagccgcggggcagcgccggcatcatgacggtggacggagag
gcgttggcgtgcgagcccgtgcaggggcagatccacggccacatgtgccgcgtggtcacc
gcttcgtag

DBGET integrated database retrieval system