KEGG   Gallus gallus (chicken): 427803Help
Entry
427803            CDS       T01006                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
gga  Gallus gallus (chicken)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    427803 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    427803 (SPHK1)
   04020 Calcium signaling pathway
    427803 (SPHK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     427803 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
18
AA seq 462 aa AA seqDB search
MQPLGSSERRKNRFIRQQQLPWHPFLPPRRYRRPLRGGKEEERSPPAAPRRCVRETAAGK
WWKRCRSPASGGERGDGAATLGFHCSGVSYGLLPRPCRALVLLNPQSGAGRALEDFQAVV
QPMLADADIAATVFVTERPHHAQEKVRDEDLSQWDVLVVMSGDGLLHEVLNGLMERPDWE
EALQTPLCILPGGSGNALAASINYYAGNDHVAKKKLLTNCTFILCKGLHAPMDLVSLSTA
SGKRFFSFLGFGWGFIADVDIDSEKYRRLGNARFTLGTLQCLVRLRVYQGRLSYLPAATE
PGTPRDRKAPARRAAPTAGTEAPSGHGALPADTLLVPLGQPVPPHWVVVPEEEFVCVYAI
YQSHLGTNLLMAPAARLHDGCIHLFYVGAGISRVALLKIFLAMGRGTHLDLNCPHLHCVP
VRAFRLEPRGSAGIMTVDGEALACEPVQGQIHGHMCRVVTAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccttgggagctcggaaaggaggaaaaacagatttataaggcaacagcagctt
ccgtggcatccttttcttcctccccgccgctatcgccgccccctaaggggtgggaaggag
gaggagaggagccctcctgccgccccgcggcgctgcgtgagggaaaccgctgctgggaag
tggtggaagcgctgccgcagccctgcatctgggggagagcggggagatggagcggccaca
cttggattccattgctccggtgtcagctatgggctgctgccccggccctgccgagctctg
gtgctgctgaacccgcagagcggcgctggccgcgcccttgaggacttccaggcggtggtg
cagcccatgctggctgatgcagacatcgcagccaccgtctttgtcaccgagagaccccac
cacgctcaggagaaggtgcgggatgaagacctgtcgcagtgggatgtgctggtggtgatg
tctggggatggtctgctccacgaggtgctgaatgggctgatggagcggccggactgggag
gaggccctgcagacaccgctgtgcatcctgcccgggggctccgggaatgccctggctgcc
tccatcaactactatgcgggcaacgaccacgtggccaagaagaaactgctgaccaactgc
accttcatcctgtgcaaagggctgcacgccccgatggacctggtctcgttgagcacagcc
tcgggcaaacgcttcttctccttcctgggcttcggatggggtttcatcgccgacgtggac
atcgacagcgagaagtaccggcggctgggcaacgcgcgcttcacgctgggcacgctgcag
tgcttggtgcgcctgcgcgtctaccagggccgcctctcctacctgcctgcggccaccgag
ccgggcacccccagggaccgcaaggcgcccgcccggcgggccgcaccaacagcggggacg
gaggcgccgagcgggcacggggcgctgcccgctgacacgctgctggtgccgctggggcag
ccggtgccgccgcattgggtggtggtgcccgaggaggagttcgtctgcgtctacgccatc
taccagtcccacctgggcaccaacctgctgatggccccggcggcgcggctgcacgacggc
tgcatccacctcttctacgtgggggcgggcatcagccgcgtggcgctgctgaagatcttc
ctggccatgggcaggggcacgcacctggatctgaactgcccccacctgcactgcgtcccg
gtgcgcgccttccgcctggagccgcggggcagcgccggcatcatgacggtggacggagag
gcgttggcgtgcgagcccgtgcaggggcagatccacggccacatgtgccgcgtggtcacc
gcttcgtag

DBGET integrated database retrieval system