KEGG   Gallus gallus (chicken): 427864Help
Entry
427864            CDS       T01006                                 

Gene name
DYRK2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     427864 (DYRK2)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   427864 (DYRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 526 aa AA seqDB search
MNEHLHVGSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTLGKSGLPVVQDRQSESAHRRQG
SSSSLKSTDGTGKVKASVMTPEQAMKQYMQKLTTFEHNEIFGYTEIYFLGPNAKKRQGVI
GGPNNCGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKMHQHVALKMVRN
EKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRSHICMTFELLSMNLYELIKKN
KFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYE
HQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMI
ELLGMPSPKLLDSSKRAKNFVSSKGYPRYCTITTLSDGSIILNGGRSRRGKLRGPPESRE
WGNALKGCDDPLFLDFLKQCLEWDPAIRMTPSQALRHPWLRRRLPKPPTGEKASAKRITE
STGAITSISKLPPTSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcacctccatgttggtagccatggacaaatccaggttcaacaactgtttgaa
gataatagtaacaagaggacggttctgacaacacagccgaatggacttacaacgctaggc
aaatctggattgccagtggttcaggacagacagtcagagagtgctcacagacgacaaggg
agctccagctctttaaaatctacagatggaacagggaaggtgaaagcctccgttatgaca
ccagagcaggcaatgaagcaatacatgcaaaaactaacaacttttgaacataatgagatt
tttggctacactgaaatatactttttgggtccaaatgcaaagaagcggcaaggtgtgatt
ggtggtccaaacaattgcgggtatgatgatgaccaggggtcgtacatacaagtaccccac
gatcatattgcatacagatatgaagtcctgaaagttatcgggaaaggaagctttgggcag
gtggtgaaagcctacgatcacaagatgcatcaacacgtggcactaaaaatggtgagaaat
gaaaagcgtttccaccgccaagctgcggaagaaattaggattctggagcatctccggaaa
caagacaaggataacaacatgaatgttattcacatgttggaaaacttcacattccgcagc
catatctgcatgacatttgaattgctgagcatgaacctgtatgaattaataaagaagaac
aagtttcagggctttagcctgcctttggtccgcaagtttgcccactccattttacagtgc
ttggatgctttgcacaaaaacagaattatccactgtgaccttaaacctgagaacattctg
ttaaagcaacagggccgaagtggtatcaaagtgatcgattttggctcaagttgttatgag
catcagcgtgtctacacttacattcagtcacgtttttatcgcgcgcctgaagtcatcctt
ggtgctcgttacgggatgcccatcgatatgtggagcttgggatgtattctagcagagctt
ctcaccggctatccacttttacctggagaagatgaaggagaccagctggcttgtatgatt
gagctgttgggcatgccttccccaaaacttttagattcatccaagcgagccaaaaacttt
gtgagctctaagggttatccccgctactgcaccatcacaaccttgtccgatggttctata
atactgaacggtggacgctctcggaggggaaaattacgcggcccaccagagagcagagaa
tggggtaacgcattaaaggggtgcgacgatcccctgttccttgactttttaaaacagtgt
ttagaatgggatcctgctatccgaatgacacccagccaggctttgcgacatccctggcta
aggcgacggttgccgaagcctccgactggggagaaggcctcagcaaagagaattacagag
agcactggtgctataacgtcgatttccaagttacctccgacttcaagctcagcttcaaaa
ctgaggactaatttggcacagatgacagatgccaatgggaatattcagcaaagaacagta
ttgccaaaactcgttagctga

DBGET integrated database retrieval system