KEGG   Gallus gallus (chicken): 427886Help
Entry
427886            CDS       T01006                                 

Gene name
HIST1H2B8, H2B-VIII, HIST1H2BO
Definition
histone cluster 1, H2B-VIII
Orthology
K11252  
histone H2B
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   427886 (HIST1H2B8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKTRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaccagcgaagtcggctcctgcccctaagaagggctccaagaaggcggtcacc
aagacccaaaagaagggcgacaagaaacgtagaaagacgaggaaagagagctactcgatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgg
ctgctgctgcccggcgagctggccaagcacgcggtctctgagggcaccaaggcggtcacc
aagtacaccagctccaagtag

DBGET integrated database retrieval system