KEGG   Gallus gallus (chicken): 427887Help
Entry
427887            CDS       T01006                                 

Gene name
H3F3C, H3-I, H3-II, H3-III, H3-IV, H3-V, H3-VI, H3-VII, H3-VIII, H3F3A
Definition
H3 histone, family 3C
Orthology
K11253  
histone H3
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   427887 (H3F3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaccaagcagaccgcccgcaagtccaccggcggcaaggcgccccgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccctctactggcggggtgaagaagccgcac
cgctaccggcctggtaccgtggccctccgtgaaatcaggcgctatcagaagtcaaccgaa
cttttgatccgcaagcttcccttccagcgtctggtgcgtgaaattgctcaggacttcaaa
acagatctgcgcttccagagcgctgctatcggtgctttgcaggaggcaagtgaagcctac
ttggttggcctgtttgaagataccaacctgtgtgctatccatgccaaacgtgtcacaatc
atgccaaaagatatccagctagcacgccgcattcgtggggagcgtgcctaa

DBGET integrated database retrieval system