KEGG   Gallus gallus (chicken): 427964Help
Entry
427964            CDS       T01006                                 

Gene name
GBE1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gga  Gallus gallus (chicken)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    427964 (GBE1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     427964 (GBE1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   427964 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
1
AA seq 798 aa AA seqDB search
MPSESRRCARLRAAQRPAERRRNLSQRSHPVPLPGSPSVAARTTRSPGLPPRPRPRGTRR
AGSGGGGGRLSVPGLPPPEVRGKSEVLEDYLFIFKVIVKELCGDVTTSAINHFLAGAKIK
VVRYALFYKRLKSIDDNEGGLNKFSKSYKSFGVNQFVDGGVYCKEWAPGAEAVFLTGDFN
GWNPFSHPYKKMEYGKWELFIPPGQDGFSPVPHGSKLKVVIRAQNGELLYRISPWARYVV
RYEGKVNYDWVHWDPPQSYIRKHRSPKKLKSLRIYESHVGIASPEGKIASYKNFTYNVLP
RIRDLGYNCIQLMAVMEHAYYASFGYQVTSFFAASSRYGTPDDLKELIDVAHSMGITVLL
DVVHSHASKNSEDGLNKFDGTDSCFFHSGPRGTHRIWDSRLFDYANWEVLRFLLSNLRMW
IEDYGFDGFRFDGVTSMLYHDHGIGKEFSGDYNEYFGLDVDEDALCYLMLANHMINFLHP
DCITIAEDVSGMPALCRPVAEGGGGFDYRLAMAIPDKWIKIIKELKDEDWNMGNIVYTLT
NRRCDEKYIAYAESHDQALVGDKTLAFRLMDAEMYTNMSVFTPLTPVIDRGIQLHKMIRL
ITHTLGGDGYLNFMGNEFGHPEWLDFPRKGNNESFHYARRQFNLTDDHLLRYKFLNEFDR
DMNKLEEKFGWLASPPAFVTEKHESNKVIAFERAGLLFIFNFHPYESYVDYRVGVEVPGK
YKILMDSDASEYGGHQRLDHNTEYFSEEYPHNYRPNSVMQSNSQTSFSQHSRRCHKHLIK
VYIPSRVAIVLQNTDVPQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagagtcgcgtcgctgcgctcgactgcgagctgcccagcgccccgccgagcgg
cggaggaatttatcgcagcgctcgcaccccgtgccccttccagggagcccgagcgtcgcg
gccaggaccacccgcagccccggcctcccaccccgcccaaggccgcgaggcacacggcgg
gcggggagtggcggcggaggcgggcggctctcggtcccggggctgcccccgccggaagtg
agaggaaaatctgaagtgctagaggattatctatttatttttaaagtgattgtgaaggag
ctgtgtggagatgtcactacatctgcaattaaccatttcttagctggtgcaaaaatcaag
gtagttaggtatgctctgttttataaacgcttgaagagcattgacgacaatgaaggaggt
cttaataaattttcaaaaagttacaaatcttttggagttaatcaatttgtggatggtgga
gtatattgcaaagagtgggcaccaggtgcagaagcggtgtttctcacaggtgatttcaat
ggctggaatccattttctcatccatataagaaaatggagtatgggaaatgggagttgttc
attccacctggacaagatggtttttctcctgtgcctcatggatcaaagctaaaggtggtg
attcgtgctcaaaatggcgaactcctctatcgtatttcaccatgggcaagatatgtagtc
cgttatgaaggcaaagtgaattacgattgggtacactgggatccaccacagtcatatata
cgtaagcatcgttcccccaagaaattaaaaagtctgagaatctatgaatctcatgtggga
attgcttctccagaagggaaaatagcttcttataaaaacttcacatataatgtactaccc
agaataagggatcttggctataactgtattcagctgatggctgttatggaacatgcatat
tacgccagctttggttatcaggtcacaagcttctttgcagcatcaagccgttacggaact
ccagatgatctgaaagaattgatagatgttgctcattcaatgggtatcactgttctgctg
gatgttgtgcacagccatgcatcaaaaaactcagaagatggtctcaacaaatttgatggt
acagattcttgtttcttccattctggacctagaggaactcatcggatctgggacagcagg
ctctttgattatgcaaactgggaagttttgagattccttttgtccaatctgagaatgtgg
atcgaggattatggttttgatggcttccgatttgatggtgttacgtctatgctgtatcac
gatcatgggattggcaaagaattcagtggggattacaatgaatattttggcctagatgtg
gatgaagatgctttgtgttatctgatgctggccaaccacatgattaacttcttgcatcca
gactgcataacaatagcagaggatgtttctggaatgccagctctttgccgtcctgttgca
gagggaggaggaggatttgattatcgactagccatggctattccagataagtggataaag
ataattaaggagttgaaagatgaagactggaatatgggcaatattgtatatacattaaca
aacagacgatgtgatgagaaatatattgcatacgcagagagccatgaccaggcacttgtt
ggtgataagacattggcatttcgattgatggatgcagagatgtacacaaacatgagtgtg
ttcacacctcttactccagttattgatcgcggaatccagcttcataaaatgattcgcctc
attactcacacgcttggaggagatggctatctgaacttcatgggtaatgaatttgggcat
ccagaatggcttgacttccccagaaaagggaataatgagagctttcactatgccagaaga
cagttcaatcttactgatgatcatcttcttcgctataaattcctaaatgagtttgataga
gatatgaataaattggaagaaaaatttggctggcttgcatctcctccggcttttgtgact
gaaaagcatgaatccaacaaggtcattgcatttgaaagagctggtctcctttttattttc
aatttccatccatatgaaagttacgtggactacagagtgggtgttgaagttccaggaaag
tataaaatccttatggattctgatgcttcagaatatggaggacatcagaggttggaccac
aatacagagtacttctctgaagaatatcctcacaattatcgacctaattcagttatgcag
tccaattcacagaccagcttcagccaacactccagaagatgccacaagcacctcataaag
gtgtacattccaagcagagtggctattgtgcttcagaatacggatgtcccacagtga

DBGET integrated database retrieval system