KEGG   Gallus gallus (chicken): 428071Help
Entry
428071            CDS       T01006                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
gga  Gallus gallus (chicken)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    428071 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    428071 (CYSLTR2)
G protein-coupled receptors [BR:gga04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    428071 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 310 aa AA seqDB search
MNSSEMMLNDSSTNSSFNCSTDAFKQVIYPIVYLLIFFLGSVGNSLSIYVFLQPSQRKTS
VNTYMQNLAVSDLMFVSTLPFRATYYLLGSQWVFGDILCRIMTYTMYVNMYCSIYFLTVL
SVVRFTAIVYPFKSWKVSNMKYAKIMCAVIWVFVLAASSPLLSKAIAGYENPAKCLDLHP
SSTHRLLMMNSFVLVVGFILPFCTIIVCYIFAIRALLKSKTPQRKKAVCHKKALSTIIIT
LILFLLCFLPYHILRTVYLVFGGCSPDNLFVHKAQVVSLCLAATNSCLDPVLYYFAAENF
KARIRSLYRR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttctgagatgatgctaaatgacagctccactaacagctcattcaactgtagc
acggatgccttcaagcaagtcatttatcccattgtgtacctcttaatctttttcctgggc
agcgttggaaatagcctctccatatatgttttcctccagccttcccagaggaagacctca
gtaaacacttacatgcagaacttggcagtttcggatctcatgtttgtgagcactttgccc
ttccgggccacctattacctgttgggatcacaatgggtgttcggagatatcctctgcagg
atcatgacgtacaccatgtatgtgaacatgtactgcagcatttattttctcaccgtgctc
agtgtggttcgattcacggccatcgtctacccatttaagagctggaaagtaagcaacatg
aagtatgccaagataatgtgcgcagtgatatgggtctttgttctggcggcctccagccct
ctgctgagcaaagcaattgctgggtacgaaaacccagccaagtgcttggacctccacccc
agcagcacacacaggctcctcatgatgaacagctttgtccttgttgtgggcttcatcttg
cctttttgcacgattatcgtctgctacatctttgccatcagagcgctgctcaagtccaag
actccccagcgcaagaaggcagtctgtcacaagaaagcactgtcaaccatcatcatcact
ctcatcctcttcctcctgtgcttcctgccataccacatactgcggacagtctacctggtg
ttcggtggctgcagcccggacaatctgtttgtgcacaaagcacaggtggtctcgctctgc
cttgctgccaccaacagctgccttgaccccgtgctatattacttcgctgctgaaaatttc
aaagcaagaatcagaagtttataccgaaggtag

DBGET integrated database retrieval system