KEGG   Gallus gallus (chicken): 428078Help
Entry
428078            CDS       T01006                                 

Gene name
USP12
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     428078 (USP12)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   428078 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 402 aa AA seqDB search
MGPHFSTLNVTAYHLIPPDNFVKILRTLPCLFPMLIGRILRWLILTLCLGANASALEKEI
GPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFRDKVLAYKSQPRKKENLLTCLADL
FHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQE
KQNGRLPNGNIDNENNSPPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQ
NTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQL
HRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFW
LLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggacctcacttctctactcttaacgtgacagcctaccatttgatacccccagacaat
tttgtgaagattctcagaacacttccttgcctcttccccatgcttattggaagaattctc
aggtggttgattctcaccttatgcctgggcgccaatgcctcagctttggagaaagagatt
ggtccagaacaatttccagtcaatgaacactattttggtttagttaattttgggaataca
tgctactgcaattcagttcttcaggcactttatttttgtcgtccatttcgagacaaagtc
ttagcatacaagagtcaaccaagaaaaaaagagaatctccttacatgcttagctgacctc
ttccacagtatagccacccagaagaagaaagttggagttatacctcccaagaaatttata
acaagattacgaaaagaaaatgagctttttgacaactacatgcagcaggatgcacatgag
ttcttaaactacctactaaatacaattgcggatatcttgcaagaggaaagaaaacaagag
aagcaaaatggtcgcttacccaatggcaatattgataatgaaaataacagcccaccagac
ccaacgtgggttcatgaaatctttcagggaacattaacaaatgaaaccagatgtcttacg
tgtgaaactataagcagcaaagatgaagacttcttagatctttctgttgatgtagaacaa
aatacttcaattactcactgcttaaggggtttcagcaatacagaaactctgtgcagtgaa
tacaaatattactgtgaagaatgtcgcagtaagcaagaagcacataaaaggatgaaagta
aaaaagctgcctatgattctagctctccatctgaagagatttaaatatatggatcagctg
catagatacacaaaactctcttatagagtagtttttcctttagagcttcgtttatttaac
acctcaggagatgccaccaatcctgacagaatgtatgacctcgttgctgtggtagttcat
tgtggaagtggccctaacagaggacattatattgcaatagtgaagagtcatgatttttgg
ttgctttttgatgatgatattgttgagaaaattgatgcacaagctattgaagaattctac
gggttgacgtcagacatctcaaagaactctgagtctggttacatcctcttctatcagtct
cgggattga

DBGET integrated database retrieval system