KEGG   Gallus gallus (chicken): 428123Help
Entry
428123            CDS       T01006                                 

Gene name
MADPRT, ART7.2
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     428123 (MADPRT)
Cellular antigens [BR:gga04090]
 Proteins
  428123 (MADPRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
MEHAILGLVLLLSTRTDASAARSKKGPIKEVAMDMAPHSFDDQYQGCIHLMEAELEELNR
TEFANETFAEEWRNATEKWQRRWGRVSSPMVLRQDQAIAMLAYTMEGELYRVFNNATLTA
GRSRQHYLSSYPFKALHFLLSRALHTLRESQTQRCHNVFRGVRGTRFTAQQGTVVRFGQF
ISSSLRKKVAEFFGLDTFFSVETCYGVPIKEFSTFPGEDEVLIPPFEQFRVTNSTYTEGR
SFIQLRSQGKSSTYNCEFVKEKRCKERPCAFSADKSSPQPRSPWPGWAPLAAPHSH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgccattctgggcttggtgctgctgctcagcaccaggactgatgcatcggct
gccaggagcaagaaaggccccataaaggaggtggcgatggacatggccccccactccttt
gatgaccagtaccagggctgcatccacttgatggaggctgagctggaggagctgaaccgc
accgagttcgccaacgaaacctttgctgaggaatggagaaatgccacagagaagtggcag
cgccgatggggtcgggtctccagcccaatggtgctgcgacaggatcaagccatagccatg
ctggcgtatacaatggagggagaactgtaccgtgtgttcaacaacgccacgctcacggct
gggcgctcccggcagcactacctgagctcctaccccttcaaggcactgcatttcctactg
agcagagccctgcacaccctgcgggaatcccaaacccagcgatgccacaatgtcttccgt
ggcgtcaggggcacccgattcactgcacagcaaggcacggtggttcgctttggccagttc
atttcctcctccctccggaagaaggttgctgagttttttggcctggacacgttcttctcg
gtggagacctgctatggtgtgcccatcaaggaattctccactttccctggtgaggacgaa
gtcctcatcccacccttcgagcaattcagggtcaccaactccacctacactgagggaaga
agcttcatccagctccgctcccaggggaagagcagcacctacaactgcgagttcgtgaag
gagaaaaggtgcaaggagcggccatgcgctttcagtgcagataagagcagtccccagccc
cgcagcccctggccaggttgggcacccctagcagccccccacagccattaa

DBGET integrated database retrieval system