KEGG   Gallus gallus (chicken): 428167Help
Entry
428167            CDS       T01006                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    428167 (AURKA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     428167 (AURKA)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   428167 (AURKA)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     428167 (AURKA)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    428167 (AURKA)
   Spindle formation proteins
    428167 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    428167 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
20
AA seq 409 aa AA seqDB search
MDRKTKENCPGNPSRATKVANPVVDGPKRVPVPQNSAQSRPLNSGVQPQRVLCPSNFAQR
VPVQSQKSSLSNQKLSNNQTTQQPRPKLPVQPTAGPQVPSKNSEKPQQAPVPAKSSEADS
VSKQKNEESTKKKKEETKKRQWSLDDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFK
AQLEDAGVEHQLRREVEIQSHLRHPNILRLYGYFHDVTRVYLILEYAPRGEVFKELQKLT
KFDEQRTATYITELADALSYCHSKSVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRR
STLCGTLDYLPPEMIEGRTHDEKVDIWSLGVLCYEFLVGKPPFEAQTYQETYRAISRVEF
KYPLFVTEGARDLISKLLKHNPFHRLPLKDVLVHPWITANSTKLPNNRK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaagacaaaagaaaactgtcctggaaacccttctcgtgctactaaggtagca
aatcctgttgtggatggcccaaaacgtgtccccgtgcctcagaattctgcccagagccgg
ccgctgaacagtggagttcaaccacagcgtgttctgtgtccttcaaattttgcccagcga
gttcctgtacagtcacaaaaatcttcactgtcaaaccaaaaactgtctaacaatcagaca
acgcagcagccccgaccaaaacttccagtccagccaactgctgggcctcaggttccaagc
aagaatagtgaaaaacctcaacaagctcctgtacctgcaaagagttctgaagcagacagc
gtatctaaacagaaaaatgaagagtctactaaaaagaaaaaggaggagactaaaaaaaga
cagtggtctcttgatgattttgaaattggtcgtcctctggggaaagggaaatttggaaat
gtatacttggcacgtgaaaagcagagtaaatttattcttgcactgaaagtgctgtttaaa
gcacagcttgaggatgctggggtagaacatcaactacgaagagaagttgaaatacagtct
catctcaggcatcccaacattctcagactgtatggctacttccatgatgttacacgagtc
taccttattctagagtatgcacctcgtggagaagtcttcaaggaactacagaagcttacc
aaatttgatgaacaaagaactgcaacttacattaccgaactagcagatgccctatcatac
tgtcattcaaagagcgtgattcaccgggacatcaagccagaaaacctgctgcttggctct
aatggagaattaaaaattgcagactttggatggtctgtgcatgctccatcctctaggaga
tcaaccctctgtgggacacttgactacttgcctcctgaaatgattgagggaagaacacat
gatgaaaaggtggatatttggagcttgggggttctgtgctatgaattccttgtagggaag
ccaccttttgaagcacaaacatatcaagaaacctacagagctatttccagggtggaattc
aagtatccattatttgtaacagaaggtgcaagggatttaatttcaaagcttctgaaacat
aaccctttccatcggctgcccttgaaggatgtacttgttcatccctggattacagcaaat
tctacaaagctgcccaacaatagaaagtga

DBGET integrated database retrieval system