KEGG   Gallus gallus (chicken): 428171Help
Entry
428171            CDS       T01006                                 

Gene name
PADI1, cPAD1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
21
AA seq 689 aa AA seqDB search
MSQRQVIQMSTSHASYGVCVLGTEVFLDTHRSTPKGATSFDVHATSAVTVHIIHSPMTKP
MLNSRWPLDPDIEVVVTIGVTSKTVNDNKVKISYYGREENEISVAWLYLTCVDISLDVDV
SRNGRVRSKGKDKAKWTWGPDGQGAVLLVNCDKDSPSTVGTDSSQVDIHTPADLQDMSVM
LLRTQGPSSIFADYQLVLHVSESDADKVRVFHAIRSDSHPRYKPVLGPGMLSCLLDCVRS
GENTFYVEGLAFPDAGFSGLVSISVSLLEVPHKVCGIYPTPDPTEPPLGLPTTSPGVLPL
QYSPGTPVFTDTVVFRVAPWIMTPNTQQPLEVFVCSIKRGINSNEVFLEELQALLRKANC
KMTICSEVESRSDRWIQDELEFGYVEAPHKSFPVVFDSPRNRGLKDFAFKKILGPDFGYV
TRVPPGCDACSLDSFGNLDVSPPVTVRGKEYPLGRILIGSPLPWASGRRMSKVVRDFLYA
QKVQAPVEVYSEWLSVGHVDEFLTFVPAYDRKGFRLLLASPTACFKLFQEKQRQGHGEAT
QLVGMVGCERRSIDDILADEGLRNDNKHVQRCIDWNRDLLKHELGLSEQDIIDIPQLFIL
RGSRAEALFPDMVNMLVLGRHLGIPKPFGPLVAGQCCLEERVRALLQPLGLSCTFINDFF
SYHVLSGDVHCGTNVRRKPLAVKWWHVVP
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcgccaggtcattcagatgtctaccagtcatgccagctacggggtctgcgta
ctgggcaccgaggtcttccttgacacccaccgatctacccctaaaggtgccacgtcattt
gatgttcatgccacatccgctgtcacagtccacatcatccacagccccatgacaaaaccc
atgcttaactccagatggccactggatcccgatatagaggttgtagtgaccattggtgtc
accagcaagactgtcaatgacaataaggttaagatttcatactacggacgggaagagaat
gagatttcagtggcttggttgtacctcacctgtgtagatatatccctggatgtggacgtg
agccgtaatggcagagtgaggagcaaagggaaggacaaggccaagtggacatggggacca
gatgggcaaggggctgtgctgttggtcaactgtgacaaggacagccccagcacggtgggg
acagacagcagccaagtggacatacatacccctgcagacctgcaggacatgtctgtgatg
ctgctgcggactcaaggtcccagcagtatctttgctgactaccagcttgtccttcatgtc
tccgagtcagatgcagacaaggtgcgggttttccatgctatccggagtgactcacacccc
cggtacaaacccgttttgggaccaggcatgctctcctgcctgctagactgtgtcagaagt
ggagaaaacaccttctacgtggaagggctggctttccctgatgcaggtttctctgggttg
gtttctatcagcgtcagcttgctggaggtgccccataaggtatgtgggatctaccccacc
cctgaccccacagagcccccactgggtttaccaaccacttctcctggtgttttgcccttg
cagtattctcctgggacccccgttttcacagatacagtggttttccgcgtggcgccctgg
ataatgacacccaacacccagcagcccctggaggtgtttgtctgcagcatcaagagggga
atcaactccaatgaagtctttctggaggagctccaggccctgctgaggaaagccaactgc
aagatgaccatctgctccgaggtcgaaagccgcagtgaccgctggatccaggacgagctg
gagtttggctacgtggaggcaccacacaagtccttccctgtggtcttcgactcgcccagg
aacagaggcttgaaagactttgcttttaagaagattttgggccctgattttggctatgtg
acccgtgtgccccctggatgtgacgcctgcagtcttgactcctttggcaacctggatgtg
agccctccagtgacagtgcgaggcaaagagtatcctctgggacgtatcctcattggcagc
cccctgccctgggcctccggccgtcggatgtcgaaagtggtcagagatttcctttacgcc
cagaaggtgcaggcgccagtggaggtctactcagagtggctgagcgtgggccatgtggat
gagttcctcacctttgtccctgcatatgacagaaagggattccggctcctcttggccagc
cccactgcctgcttcaagctcttccaggagaagcagaggcagggacacggcgaggccaca
cagctcgtgggaatggtgggctgcgagcggaggagcattgatgacatcttggcagatgaa
gggctgaggaatgacaacaaacatgtgcagcgctgcattgattggaaccgcgacctgctc
aagcatgagctgggcctgagtgaacaggacatcatcgacatcccgcagctcttcatcctg
cggggttcccgtgcagaagccctcttcccagacatggtgaacatgctggtgctgggcaga
cacctgggcatccccaagcccttcgggccactggtggccgggcagtgctgcctggaggag
cgggtgcgggcactgctgcagcccctggggctctcctgcaccttcatcaatgatttcttt
tcctaccatgtcctttctggagatgtgcactgtggcaccaatgtccgccgtaagcccttg
gccgtcaaatggtggcacgtggtgccctaa

DBGET integrated database retrieval system