KEGG   Gallus gallus (chicken): 428203Help
Entry
428203            CDS       T01006                                 

Gene name
ADRA1A
Definition
adrenoceptor alpha 1A
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
gga  Gallus gallus (chicken)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    428203 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    428203 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428203 (ADRA1A)
   04270 Vascular smooth muscle contraction
    428203 (ADRA1A)
G protein-coupled receptors [BR:gga04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    428203 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
22
AA seq 467 aa AA seqDB search
MVFLPGNSSNCSNCTYSAEPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLQSV
THYYIINLAVADLLLTSTVLPFSATMEILGYWAFGRIFCNIWAAVDVLCCTASIMSLCII
SIDRYIGVSYPLRYPSIVTEKRGLLALLCVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSALGSFYLPLTIILVMYCRVYVVAKRENKGLRSGLKMEKSRSEAVTLRIHRKN
VPENSGATASSKSKHHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFVVMPLGSFFPT
IKPPDTLFKITFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLPRKHAAKKQSPSFN
LNHPSNQSMGGGKGVVRIPVGSGETFYKISKSDGVCEWKIFSAVQSVPTKSAIPKDKSSC
TAAKVKSKGFLQECCCAGTSGNTVHENCKVPTIKIHTMSLSESGEDV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggttttcctccctgggaactcatccaactgttccaactgcacctactctgcagagccc
gtgaacatttccaaggccattttgctgggtgtcattctaggggggttgatcatttttggg
gttttgggtaacattctggttatcctctctgtagcctgtcacaggcatcttcagagtgtc
acccactactatataattaacctggctgtagccgacctcctcttgacatccactgtcctg
cccttctcagctactatggagattttgggctactgggcctttgggaggatcttctgcaac
atctgggcagccgttgacgtcctttgctgcactgcatccattatgagcctctgcatcatc
tcgatagacagatacatcggggtgagctacccactgcggtaccccagcatagtgacggag
aagagaggcctcctggctctgttgtgcgtgtgggcgctgtctctagtcatctccattgga
cctctttttggatggaaggaaccagcacccgaagatgagaccatctgccagatcaccgaa
gagcccggctatgtgctgttctccgcgctgggctccttctacctccccctgaccatcatc
ctggtgatgtactgccgagtgtacgtcgtggccaaaagggaaaacaaaggtttgaggtcg
gggctgaagatggagaaatctcgttccgaagcagtcaccctacggatccaccgcaaaaac
gttcccgaaaacagcggggccacggccagctctaagagcaaacatcacttctcggtgcgt
ctcctcaagttctccagggaaaagaaagcagccaagaccctgggaattgttgtgggatgc
tttgttctgtgctggcttcctttttttgtagtcatgcctcttggttctttctttcctaca
atcaaacccccggacacactttttaaaataacattctggcttggatatttaaacagctgc
atcaaccccatcatctatccatgctccagtcaagagtttaagaaagcgttccaaaatgtc
ctgagagcgcagtgcctcccaagaaagcacgcagcaaagaagcaatccccaagcttcaac
ctcaaccatcccagcaaccaaagcatgggaggtggcaaaggcgtagtccgtatccccgtc
ggctcaggggaaaccttctataagatttccaaatccgatggggtctgcgaatggaagata
ttctccgccgtgcaaagcgtgccgacaaaaagtgcgattcctaaggacaagtccagctgt
actgctgccaaagtgaaaagcaaaggtttcctccaggagtgctgctgtgcgggcacttcg
gggaacacggtccatgaaaactgcaaagtgccgaccattaaaatacacaccatgtccctc
agtgagagcggggaggatgtctaa

DBGET integrated database retrieval system