KEGG   Gallus gallus (chicken): 428279Help
Entry
428279            CDS       T01006                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C, delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    428279 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    428279 (PLCD3)
   04070 Phosphatidylinositol signaling system
    428279 (PLCD3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    428279 (PLCD3)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     428279 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
27
AA seq 907 aa AA seqDB search
MGSHSWGSLWSGIPMVGIPMIEGPHGQGCPYGQGVGGPEFGSSPQLGVRAVSGPHGREQP
FPTPGAVHGPGAVVKEWFQKINKKEEIISWRMDGNVPSDRACGHRQPGDRVGVGRAGGSP
APGAPTLDCSSFAGVAQPWPRAQQWLSEDEDLQLMLQGSLLRKVTSRRAKERRFRLQEDG
VTVVSERRFGRAPSKQSFSVAHITAVHRGHHSEGLRRYGRAIPEQHCFTIAFEGGRRNLD
LGARDEDVALSWVRGLRTLRGRLRGMSQRERLEHWIHGMLQRADRDKDNRMCFQEVQIML
RMANIHMDNAYTHQLFEECDHSGDGRLEDRELEDFCRRLLRRPELEELFGRYSGEDCVLS
AEELRDFLQDQGEEGTLQQACAIICAHELNEKVPGFSTALPGDIHMGTTHEVPPLPHPPA
RQQDLMTLDGFTMYLLSPAGDILNQEHTQVHQDMSQPLCHYFISSSHNTYLTRNQIGGTS
STEAYVRALMMGCRCVELDCWEGPDGEPIISHGHTFTSKILFRDVIEAIRDYAFKRSPYP
VILSLENHCGVKQQATMAQHMKAILGDMLLTQPLEGQDPSVLPSPEQLKGKVLVKGKKLP
ELQPEPCGVTSILDEEEEEETEEEDRLQAKDASHVAPELSAMVVYCQATPFPGLAQALQH
PRPYEMSSFSERKARKLIKEAGPAFMRYTSRQLSRVYPLGLKMTSSNYNPQEMWNAGCQL
VALNFQTPGYEMDLNTGRFLGNGGCGYVLKPQFLRSPHSGSPRPLVLRIRGPRGATLSPC
CPQVITAQQLPKLNREKLSSIVDPFVRVEIYGVTADCSKQQTAYRSNNGFNPRWEETLTF
QLQVPELALVRFVVEDHDSTSCNDFVGQFTLPLGSMREGYRHIHLLSKDGASLSPATLFV
HVTCRCP
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccatagttgggggtctctgtggtcagggatccccatggttggaattcccatg
attgagggtccccatggtcaggggtgtccctatggccagggtgtcgggggcccagagttt
gggagttccccacagttgggggtccgtgcggtcagcggtccccatggtcgggaacagcca
tttcccaccccaggagcggtgcacggccctggggctgttgtcaaggagtggttccaaaaa
ataaataaaaaggaggaaataatttcatggagaatggacggaaatgtcccgtcagaccgg
gcgtgcggtcaccgccagcctggggacagggttggggtggggagggcgggtggcagcccc
gctcctggtgctcccacactggattgcagcagctttgctggcgttgcacagccctggcca
agagctcagcaatggctgtcggaggatgaggacctccagctgatgctgcagggctccctg
ctgcgcaaggtgacgtcgcggcgggcgaaggagcggcggttccgcctgcaggaggatggg
gtcaccgtggtgtctgagcggcgcttcgggcgcgcgccctccaaacagagcttctccgtt
gcgcacatcacagcagtgcaccgggggcaccattcggaggggctgcgccggtacggccgt
gccatccccgagcagcactgcttcaccatcgccttcgagggcgggcgcaggaacctggac
ctgggggcacgggatgaggacgtggcactgagctgggtgcgggggctccgcacgctgcgg
gggcggctgcggggcatgagccagcgggagaggctcgagcactggatccatggcatgctg
cagcgtgccgatagggacaaggacaacaggatgtgcttccaggaggtgcagatcatgctg
cgcatggccaacatccacatggacaacgcctacacccaccagctcttcgaggaatgtgac
cactccggtgatgggcggttggaggaccgggagttggaggacttctgccggcggctgctg
cggcgcccggagctggaagagctctttgggcgctattcgggtgaggactgcgtgttgtcg
gccgaggagctgcgggatttcctgcaggaccagggcgaggagggcaccctgcagcaggcc
tgcgccatcatctgtgcccacgagctcaacgagaaggtgccagggttcagcactgcactg
cctggggacatccatatggggacaacccatgaggtgccacctttgccacatcccccagcc
cggcagcaggacctgatgacactggatggcttcacgatgtacctcctgtcacctgctggt
gacatcctcaaccaggagcatacccaggtacaccaggacatgagccagcccctgtgccac
tacttcatctcctcgtcccataacacctacctgacccgcaaccagattggtggcaccagc
agcaccgaagcctatgtcagggcactgatgatgggatgccgttgcgtggagctggactgc
tgggagggtcccgatggggaaccgatcatcagccatggccatacattcacctccaaaatc
ctcttccgtgatgtcattgaggccatccgtgattatgccttcaagagatcaccatacccc
gtcatcctctcgctggagaaccactgtggggtgaagcagcaggccaccatggcgcagcac
atgaaggccatccttggggacatgctgctgacacagcccctggaaggacaggaccccagc
gtcctcccatccccagagcagctgaaggggaaggtcctggtgaagggcaagaagctgccg
gagctgcagcctgagccctgcggtgtcacctccatcctggatgaagaggaggaagaggag
acagaggaagaggacaggctgcaggccaaagatgcatcgcatgtggccccagagctgtca
gccatggtggtgtactgccaggccacccccttccccggcctggcccaggccctacagcac
ccccggccctatgagatgtcctccttcagcgagaggaaggcccggaaactcatcaaggag
gcaggccccgcgttcatgcgctacacctcccggcagctgagccgtgtctaccctttggga
ttgaagatgacctcctccaactacaacccccaggagatgtggaacgccggctgccagctg
gtggccctcaacttccagactccaggctacgagatggacctgaacaccgggcgcttcctg
ggcaatgggggctgtggttacgtgctgaaaccccaattcctgcgcagcccccacagtggc
agcccccgccccctcgtgttgcgcatcaggggaccacgcggtgccaccctgtccccctgc
tgtccccaggtcatcacggcacagcagctgccaaagctgaaccgggagaagctcagctcc
atcgtggacccctttgttagggtggagatctatggggtgacggcggactgcagcaagcag
caaactgcctacaggagcaacaacggcttcaacccgcgctgggaggagacgctcaccttc
cagctgcaggtccctgagctggcgttggtgcgctttgtggtggaggaccacgacagcacc
tcctgcaatgacttcgtggggcagttcacgctgccgctgggcagcatgcgggaagggtac
cgccacatccacctgctctccaaggacggcgcatccctgtcccctgccacgctctttgtg
cacgtcacatgcagatgcccatga

DBGET integrated database retrieval system