KEGG   Gallus gallus (chicken): 428332Help
Entry
428332            CDS       T01006                                 

Gene name
SIRT6
Definition
sirtuin 6 (EC:3.5.1.-)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     428332 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
28
AA seq 357 aa AA seqDB search
MAVNYAAGLSPYSDKGKCGLPEIFDPPEELERKVCELADLIRSSSNVVFHTGAGISTASG
IPDFRGPNGVWTMEEKGLSPKFDTTFENARPSKTHMALLGLQRVGILKFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECMKCGKQYVRDAVVGSMGLKPTGRLCSVTKARGLRACRGK
LRDTILDWEDSLPDRDLTLADEACRKADLSVTLGTSLQIKPSGNLPLITKKRGGKLVIVN
LQATKHDRQADLRIHAYVDDVMTKLLKHLGLEVPEWTGPVVVESADSAKPEQLYTFKPEA
HGLLKEEPFSQHNGTAGQCPDLGTTLVEHRDSLKQECPSPDTGPPLTKKMKVEPLLT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaattacgcggccgggctctcgccctactcggataagggcaagtgcggcctc
cccgagattttcgatccacctgaagagctggagaggaaggtgtgtgagctggcagacttg
ataaggagctcttccaatgtggtgttccatacaggggctggcatcagcaccgcctcgggg
attcctgacttcagggggcctaatggtgtctggactatggaagagaaggggctttccccc
aaatttgacaccacctttgagaacgccaggccctccaagactcacatggcacttctgggg
ctgcagagagttggcatcctgaaattcctggtcagccagaacgtggatggccttcatgtg
cgctcaggattcccacgggacaagttggctgagctccacgggaacatgtttgtggaggag
tgcatgaaatgtggcaagcagtacgtgcgggatgctgttgtgggcagcatggggttgaag
ccaacgggcaggctgtgcagcgtcaccaaagcacgagggctacgggcctgcagagggaag
ctaagagacactattctggactgggaagattccctgcctgaccgtgacctcacactagca
gatgaagcctgcaggaaagctgatctctctgttacactgggaacctctctgcagatcaaa
cccagtggcaacctcccactgatcacaaagaagagaggagggaagctggtcatagtcaac
ctacaagcaaccaagcacgacagacaggccgacctgcgcattcatgcttacgtcgatgat
gtcatgacaaaactgttgaagcacctggggctggaagtcccagagtggacagggccagtg
gtggtggaaagtgctgactctgccaagcctgaacagctctacacatttaagcccgaggct
cacgggttgctcaaggaggagcccttttcccagcacaatggaacagctgggcagtgcccc
gaccttgggaccacgctggtggagcaccgtgacagtctgaagcaggagtgtcccagtcca
gacacaggaccaccactgacaaagaagatgaaggtagagcctctcctcacctga

DBGET integrated database retrieval system