KEGG   Gallus gallus (chicken): 428441Help
Entry
428441            CDS       T01006                                 

Gene name
KAT2B, PCAF
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    428441 (KAT2B)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     428441 (KAT2B)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     428441 (KAT2B)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    428441 (KAT2B)
   HAT complexes
    PCAF complex
     428441 (KAT2B)
    STAGA complex
     428441 (KAT2B)
    TFTC complex
     428441 (KAT2B)
    SAGA complex
     428441 (KAT2B)
    SLIK complex
     428441 (KAT2B)
    ADA-HAT complex
     428441 (KAT2B)
    HAT-A2 complex
     428441 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 901 aa AA seqDB search
MPPLPRAPEPRGPSPHSSPAAAARLRAAPRFAAAGGGRRLPPPGGTGAARGAPGPSSRPP
GEQPAAAARRRGGSRAGRTAPAGRTGGCRRAAGMAEAGGGAAAVAAGGGGPQQGSPAAGG
VAAAATGGPARSAAESPGGPGSARTAGKKAQLRAAPRAKKLEKLGVYSACKAEESCKCNG
WKNPNPPPTPPRADLQQAVVSLTEPCRSCSHTLAAHVSHLENVSEEEMNRLLGIVLDVEY
LFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVIEGSLESPPFEKPSIEQGVNNFVQY
KFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKVNYTRWLCYCNV
PQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLS
MLEEEVYSPNSPIWDQDFMVSTSRTGQLGIQTVINPPPVARSVSYCASPSSLEQPNSGNM
SPACKVSSVLDSNLGEKRKNNEPYSLEDSKRPRVVGDIPIELINEVMSTITDPAAMLGPE
TNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQNVFSHQLPRMPK
EYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMN
HLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGATLMGCELN
PRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGW
KPSGKERGKEPKDPDQLYSTLKTILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLK
TMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFFYTKIKEAGLID
K
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgccgccacttccccgggctcctgagccccgggggccgagcccgcactcgtcgcctgcg
gccgccgcccgcctccgcgcagccccgcgcttcgcagcggcgggaggcgggcgccggctc
cccccgcccggcgggacgggagccgcccgcggagcgccggggccctcctcccgccccccc
ggggagcagccggcggcggcggcgcggcgaaggggagggtctagggccgggcgcaccgcg
ccggccggccggacgggcggctgccgccgcgccgcgggcatggcggaggcgggcggcggg
gccgcggccgtggcggcgggaggcggcgggccgcagcagggctccccggccgccgggggg
gtggcggccgccgccaccgggggcccggcccgtagcgccgccgagagccccggggggccc
ggctcggcgcgcacggccgggaagaaggcgcagctgcgcgcagctccgcgggccaagaag
ctggagaagctgggcgtctactccgcctgcaaggctgaggaatcatgtaaatgcaatggc
tggaagaaccccaacccacctcccactccccctcgggcagacctgcagcaggcagttgtg
agcctcactgagccgtgccgcagctgcagccacacactagctgctcatgtttcccacctg
gagaatgtgtctgaagaagaaatgaataggctgctggggattgtactggatgtggagtat
ttgttcacctgtgtccataaagaagaagatgcagacaccaagcaagtttatttctacctg
ttcaaacttttgaggaagtgcattttacagatgggaaaacctgttattgaaggatctttg
gaaagtcccccatttgagaagcctagcattgaacagggtgtgaataattttgtgcagtac
aaatttagccacttgccctcaaaggaaaggcagacaatagtggaactggctaaaatgttt
ctgaaccgcattaactactggcacctggagacaccttctcagcgaagactaagatcgccc
aatgatgatattgcagggtataaagtgaattataccaggtggctttgttattgcaatgtc
cctcagttttgtgatagtctacctcgatatgaaaccacacaggtttttggtaggacattg
cttcgctccgtttttactgtaatgagacgacaactgctggagcaggccaggcaagagaaa
gacaagcttcctcaagagaaacggacactaatcctcacgcatttcccaaagtttctgtca
atgctggaagaagaagtgtacagcccaaattctcctatttgggatcaggatttcatggtg
tctacttctcgaactggtcagctgggaatccagacagttatcaatcctcctcctgttgca
agatctgtttcgtactgtgcaagcccgtcgtctctggagcaacccaacagtggaaatatg
agtcctgcttgcaaagtttcttctgtccttgattcaaacttaggggaaaagagaaaaaat
aacgaaccatattctctggaggactcgaaaagaccaagggttgtaggagatattcctatt
gagttgatcaatgaagtgatgtcaacaattacagatcctgcggcaatgcttgggccagag
accaacttcctctcagcacattcagctcgggatgaggcagcaagactggaggagcgcagg
ggggtgattgaattccacgtggttgggaactccctgaaccagaagccaaacaagaagatc
atgatgtggctggttggtttgcagaacgtgttttcccatcagctccctcgaatgccaaag
gagtacatcacacgcttggtttttgatccgaaacacaagactcttgcattaataaaagat
ggtcgtgttattggtggtatctgcttccgaatgttcccttcccaaggatttacagagatc
gttttctgtgctgtgacttccaatgagcaagtcaagggttacggaactcacctaatgaac
catttgaaggagtaccacatcaagcacaacattctctactttcttacgtacgcagatgaa
tatgctattggctacttcaaaaagcagggtttttccaaagatattaaagtaccaaaagca
aaatacgttggctacatcaaggattatgagggtgccacgttaatgggatgtgaattaaat
ccaaggattccctacacagaattttcagtcatcattaaaaaacaaaaggagattattaaa
aagcttatagaaaggaaacaagctcagattcgaaaagtttatcctggcctttcttgcttc
aaagatggagtacgacagattcctatagaaagcatccctggaattagagaaaccggctgg
aaaccaagcggaaaagaaagaggtaaagagcccaaggatccagatcaactttacagcaca
ttaaaaaccatcctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaacct
gtgaagagaacagaagctcctggatattatgaagttataaggtttcccatggatctcaaa
acaatgagtgaacgactcaagaataggtactacgtgtctaagaaattattcatggcagac
ttgcagcgagtctttacaaattgcagagagtacaacccccccgagagtgaatactacaaa
tgtgccaatatactggagaaattcttctatacaaaaattaaagaagctggattgattgac
aagtga

DBGET integrated database retrieval system