KEGG   Gallus gallus (chicken): 428441Help
Entry
428441            CDS       T01006                                 

Gene name
KAT2B, PCAF
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    428441 (KAT2B)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     428441 (KAT2B)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     428441 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 751 aa AA seqDB search
MHHPLPHSAYIHSLISINSQQASMKDSRYHFLCMEEFHTFAIPYQTPFCQTAPLLLSVTR
QQNVKECWREGSTSVAIPPPSASDTHQHNKIGDITFEAALKDFPGFRAKAEESCKCNGWK
NPNPPPTPPRADLQQAVVSLTEPCRSCSHTLAAHVSHLENVSEEEMNRLLGIVLDVEYLF
TCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVIEGSLESPPFEKPSIEQGVNNFVQYKF
SHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKVNYTRWLCYCNVPQ
FCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLSML
EEEVYSPNSPIWDQDFMVSTSRTGQLGIQTVINPPPVARSVSYCASPSSLEQPNSGNMSP
ACKVSSVLDSNLGEKRKNNEPYSLEDSKRPRVVGDIPIELINEVMSTITDPAAMLGPETN
FLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQNVFSHQLPRMPKEY
ITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHL
KEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGATLMGCELNPR
IPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKP
SGKERGKEPKDPDQLYSTLKTILQQVKISKQ
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacccactgcctcacagtgcttacatccactctttgatctccataaattctcag
caagcgtcaatgaaggacagtcggtaccattttctttgcatggaggaattccacaccttt
gcaattccatatcagacaccattttgtcagactgcccctctgctgctgtctgtcacacgg
caacagaatgtaaaggaatgttggcgggaaggttcgacctctgttgccataccaccacca
tctgcctctgacacgcaccaacataataaaataggagacattacttttgaagcagccctc
aaagattttcctggtttcagggccaaggctgaggaatcatgtaaatgcaatggctggaag
aaccccaacccacctcccactccccctcgggcagacctgcagcaggcagttgtgagcctc
actgagccgtgccgcagctgcagccacacactagctgctcatgtttcccacctggagaat
gtgtctgaagaagaaatgaataggctgctggggattgtactggatgtggagtatttgttc
acctgtgtccataaagaagaagatgcagacaccaagcaagtttatttctacctgttcaaa
cttttgaggaagtgcattttacagatgggaaaacctgttattgaaggatctttggaaagt
cccccatttgagaagcctagcattgaacagggtgtgaataattttgtgcagtacaaattt
agccacttgccctcaaaggaaaggcagacaatagtggaactggctaaaatgtttctgaac
cgcattaactactggcacctggagacaccttctcagcgaagactaagatcgcccaatgat
gatattgcagggtataaagtgaattataccaggtggctttgttattgcaatgtccctcag
ttttgtgatagtctacctcgatatgaaaccacacaggtttttggtaggacattgcttcgc
tccgtttttactgtaatgagacgacaactgctggagcaggccaggcaagagaaagacaag
cttcctcaagagaaacggacactaatcctcacgcatttcccaaagtttctgtcaatgctg
gaagaagaagtgtacagcccaaattctcctatttgggatcaggatttcatggtgtctact
tctcgaactggtcagctgggaatccagacagttatcaatcctcctcctgttgcaagatct
gtttcgtactgtgcaagcccgtcgtctctggagcaacccaacagtggaaatatgagtcct
gcttgcaaagtttcttctgtccttgattcaaacttaggggaaaagagaaaaaataacgaa
ccatattctctggaggactcgaaaagaccaagggttgtaggagatattcctattgagttg
atcaatgaagtgatgtcaacaattacagatcctgcggcaatgcttgggccagagaccaac
ttcctctcagcacattcagctcgggatgaggcagcaagactggaggagcgcaggggggtg
attgaattccacgtggttgggaactccctgaaccagaagccaaacaagaagatcatgatg
tggctggttggtttgcagaacgtgttttcccatcagctccctcgaatgccaaaggagtac
atcacacgcttggtttttgatccgaaacacaagactcttgcattaataaaagatggtcgt
gttattggtggtatctgcttccgaatgttcccttcccaaggatttacagagatcgttttc
tgtgctgtgacttccaatgagcaagtcaagggttacggaactcacctaatgaaccatttg
aaggagtaccacatcaaacacaacattctcaactttcttacgtacgcagatgaatatgct
attggctacttcaaaaagcagggtttttccaaagatattaaagtaccaaaagcaaaatac
gttggctacatcaaggattatgagggtgccacgttaatgggatgtgaattaaatccaagg
attccctacacagaattttcagtcatcattaaaaaacaaaaggagattattaaaaagctt
atagaaaggaaacaagctcagattcgaaaagtttatcctggcctttcttgcttcaaagat
ggagtacgacagattcctatagaaagcatccctggaattagagaaaccggctggaaacca
agcggaaaagaaagaggtaaagagcccaaggatccagatcaactttacagcacattaaaa
accatcctgcagcaggtgaagatctcaaaacaatga

DBGET integrated database retrieval system