KEGG   Gallus gallus (chicken): 428537Help
Entry
428537            CDS       T01006                                 

Gene name
MOS, c-mos
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    428537 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    428537 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    428537 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    428537 (MOS)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     428537 (MOS)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: Other group
  MOS family
   428537 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
2
AA seq 349 aa AA seqDB search
MPSPIPFNSFLPLELSPSADLRPCSSPVVIPGKDGKAFLGGTPSPRTRRLPPRLAWCSID
WDRLCLLQPLGSGGFGAVYKATYHGVTVAVKQVKKSSKNRLASRQSFWAELNVARLQHDN
VVRVVAASTCAPASQNSLGTIIMEYVGNVTLHHVIYGTRDAWRQGEEEEGGCGRKALSMA
EAVCYSCDIVTGLAFLHSQGIVHLDLKPANILITEHGACKIGDFGCSQRLEEGLSQSHHV
CQQGGTYTHRAPELLKGERVTAKADIYSFAITLWQIVMREQPYLGERQYVLYAVVAYNLR
PPLAAAIFHESAVGQRLRSIISCCWKADVEERLSAAQLLPSLRALKENL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacctattccttttaatagctttcttcctttggagctctccccatctgcagac
ttgagaccttgcagcagccctgtagttatccctggcaaagatggaaaagccttcctagga
gggaccccttcacccaggacacgccgtctgcccccacgcttggcctggtgctccatcgac
tgggatcggctctgcctcctgcagcccctgggctctgggggctttggggctgtctacaag
gccacctaccacggtgtgactgtggctgtgaagcaggtgaagaagagcagcaaaaaccgg
ctggcatcccgacagagcttctgggctgagctgaacgtagcccgactgcagcatgataat
gtggtgcgtgtggtggctgctagcacgtgtgcccctgccagccagaacagcctgggcacc
atcatcatggagtatgttggcaatgtcaccctgcaccatgtcatctacggcactagagat
gcgtggaggcagggcgaggaggaggaaggaggatgtgggaggaaggctctgagcatggcg
gaggctgtgtgctactcgtgtgacatcgtgactggcttagccttccttcactcgcagggc
atcgtgcacctcgacctgaagcctgccaatatcctcatcactgagcacggagcgtgcaag
atcggagacttcggctgctcccagagactggaggagggcttgtcccagagccaccatgtt
tgccagcaagggggcacgtacacccaccgcgctcctgagctcctcaagggcgagagggtc
actgccaaagcagacatctactcctttgccatcaccctctggcagatcgtcatgcgggag
cagccctacctgggcgagcggcagtacgtgctctatgctgtggtagcctacaacttgcgc
cctcctctggcggccgccatcttccacgagtcagcggtgggccaaaggcttcggagcatc
atcagctgctgctggaaggctgacgtagaggagcgcctcagcgcggcccagctgctcccc
agcctcagggccctgaaggagaacctctag

DBGET integrated database retrieval system