KEGG   Gallus gallus (chicken): 428564Help
Entry
428564            CDS       T01006                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
gga  Gallus gallus (chicken)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    428564 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    428564 (PFN3)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   428564 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 134 aa AA seqDB search
MNCWNYYTDCILSDKYIDDVAIVGLSDNKYVWAAKPGGLLSAVSPREVDLITGQDRITFL
TAGISIAGKKCIVIRDSLLVEGDNVMDIRSRGGDSRSICIGKTPKALIFLMGNRGVHGGV
LNLKIHDMIAGMTL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaactgctggaattattacactgactgcatcctgagcgacaagtacattgatgatgtg
gccattgtgggcctctccgacaacaagtacgtgtgggcagccaagccaggagggctgctg
tcagctgtctcacctcgtgaagtggacttgatcacaggccaggacaggataacattcctg
acggctggaatcagtatcgcagggaagaagtgcattgtgattcgtgacagcctgctggtg
gaaggagacaatgtgatggacatcagaagcagaggtggtgacagcagatccatctgtata
ggcaagacccccaaagccctgatcttcctcatgggcaacagaggagtccatggaggagtc
ctcaatctgaagatccatgatatgattgccggcatgacactgtga

DBGET integrated database retrieval system