KEGG   Gallus gallus (chicken): 428674Help
Entry
428674            CDS       T01006                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
gga  Gallus gallus (chicken)
Pathway
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    428674 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    428674 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
18
AA seq 1374 aa AA seqDB search
MESELLQSPLLGLGEEDESDLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNNYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAAPEGGSLTPVRDGPCTPRLRSV
SSYGNIRAVTTARNLNKSLQNLSLNEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
IMQVGLACRLKPQRLSNPGELVHATVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGS
PPTTSTSSSSLTNDVTKQPVSRDITSVRPANVGNMGVQYTPHSHQFPRTRKMFDKGPEQT
TDDADDTVGHKSFISATVQTGFCDWSAKYFAQPVMKIPEEHDLESQIRKEREWRFLRNAR
VRKQAQKIIQKGISRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKL
DYFHNGNPRYTRITAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSD
MLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDI
PTGADSCVTSLSCDSHRSLIVAGLGDGSIRVFDRRMALSECRVMTYREHTAWVVKAYLQK
HPEGNIMSVSVNGDVRFFDPRMPESMKVLQIVKGLTALDIHPQANLFACGSMNQFTAIYN
GNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRIR
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagctgctgcagtcgcccctcctggggctgggggaggaggatgagtcggac
ctgacggactggaacctgcctctggccttcatgaagaagaggcactgtgagaagatcgag
ggctccaagtctttggcgcagagctggaggatgaaggaccggatgaagactgttagcgtt
gccttagttttgtgcctaaatgtcggtgtggaccctcctgatgtggtgaagaccactccg
tgtgcccgcctggagtgctggatagatcctctgtcaatgggtcctcagaaagctctggaa
accattggtgcgaatttgcagaagcagtatgaaaactggcagccaagagccaggtacaag
cagagcctggatccaacggtggacgaggtgaagaagctgtgcacatccctgcggcgtaat
gccaaggaggagcgggtgctgttccactacaatgggcatggtgtgcccaggccgacggtg
aatggggagatctgggtcttcaacaagaactatactcagtatattcctctgtccatatac
gacctgcagacttggatgggcagtccttccatttttgtctatgattgctccaatgctggc
cttattgtcaaatcgttcaaacaatttgcactacagagggagcaagagctggaggtggct
gcaattaacccaaaccatcctcttgctcaaatgcctttgcctccatcgatgaagaactgc
attcagttggcagcatgtgaagctaatgaattgctccctatgatccccgatctgccggcc
gaccttttcacatcatgccttactacgccaatcaaaattgctctgagatggttttgtatg
cagaagagtgtcagactggtgccgggagtcacgctggatttgatagagaagattcctgga
agactgaatgacaggagaactcccctgggagagctgaactggatcttcacggccatcaca
gacaccattgcgtggaacgtgttgcctagagatctttttcagaagctcttcagacaagac
ctgctcgtggccagtttatttcgtaactttctcttggcagaaagaattatgaggtcctac
aactgtacccccgtcagcagcccccgcctaccgccaacatacatgcatgcaatgtggcaa
gcgtgggaccttgcagtcgatatttgcctttcccaattacctacaattatagaggaagga
actgcatttaggcacagccccttcttcgcagagcagctgacggcgttccaggtatggctg
acgatgggtgtggagaaccgcaaccccccggagcagctgcccatcgtcctgcaggttctg
ctgagccaggtgcatcggctacgagctctggatctgctgggaagatttctggacctgggg
ccctgggcagttagcttggcgctgtctgttggcattttcccgtatgtgctgaagctgctt
caaagttcagctcgtgagctgagaccgcttcttgtcttcatctgggccaaaattctcgca
gtggacagttcatgtcaagctgaccttgtgaaggacaacggccacaagtatttcctttcc
gttttggcagatccgtacatgccagctgaacacaggactatgactgctttcattctggct
gtaattgttaacaactacaacacaggacaggaagcctgccttcaaggaaacctgattgct
atttgcctggaacagctgaacgatccgcatcctctcctgcgtcagtgggtggccatttgt
ttagggcgtatttggcagaactttgactcagccaggtggtgtggtgtgagagacagcgct
catgaaaagctctacagtctcctctctgatccaatcccagaggttcgctgtgctgccgtc
tttgcactgggaacatttgtgggcaactcagctgaacggaccgaccactccaccaccatt
gaccacaacgtggccatgatgctggcccagctcatcaacgatgggagccccatggtgcgg
aaggagctggtggtggctttgagtcacctggtggttcagtatgagagcaatttctgcact
gtcgccttgcagttcatggaagaagagaagaattaccctctcccttctccagctgcccca
gagggtgggagtttgactccggtgcgtgatggtccgtgcacacctcggctgcgctctgtc
agctcttatggaaacatccgagcagttaccacagccaggaacctgaacaagtccttgcag
aacctcagtctgaacgaagaatctggaagctctgttgcgttttctcctgggaatctcagc
accagcagcagtgccagcagcaccttgggcagccctgagaacgaagagtacatcctgtcg
tttgagacgattgacaagatgagacgagtcagctcttactcttctctcaattcactcata
ggtgtgagtttcaacagtgtttatacccaaatttggagagtactccttcacctagctgct
gacccctatcccgacgtctccgacttggcaatgaaagttctcaatagcattgcctacaag
attatgcaagtgggactggcctgcagactgaagccacaacggctctccaatccaggtgaa
ctagtacatgcaacagtcaatgctcgcccccagcgcatcctggacacgtcctcactgacg
cagtcggcgcccgccagccccaccaacaagggcatgcacatccaccaagtgggaggatcg
cctccaaccactagcacaagcagctccagcctgacaaatgatgtgacaaagcaaccggtc
agccgggacatcacgtctgtgcgacctgccaacgtgggcaacatgggggttcagtacact
ccccactcccaccagttccccagaacaagaaaaatgtttgacaaagggccagaacagacc
actgatgatgctgatgataccgttggacacaaaagtttcatttcagccacagtgcagacg
gggttttgtgactggagcgcgaagtactttgctcagcctgtcatgaagatcccggaggag
cacgacctggagagccagatccgcaaagagagggagtggaggttcctacgcaacgcccgg
gtcaggaagcaagcccagaagatcattcagaagggcatctcccggctggatgatcagatc
ttcctcaacaggaaccccggcgtcccttccgtggtgaagttccatcccttcacaccctgc
atcgcagtcgctgacaaggacagtatctgtttctgggactgggagaaaggggaaaaattg
gattatttccacaacgggaacccacggtacacccggatcacagcgatggagtacctgaac
gggcaggactgctccttgctgctgacggccacagatgatggagccatcagagtatggaag
aactttgcagacctggagaagaacccggagatggtaacggcgtggcaggggctgtcagac
atgctgccaactacacgaggtctggcccgaagggtttcaatctatcttgacagaagtaag
cagggaggagcgggaatggtggtcgactgggaacaagagaccgggctgctcatgacctcg
ggagatgtgaggataatccgcatctgggacacagacagggaaatgaaagtgcaggacatc
cccaccggggcagacagctgtgtgaccagcctgtcgtgtgactcccatcggtctctgatc
gtggcagggctgggtgacggctccatccgcgtgttcgaccggaggatggctctgagcgaa
tgccgtgtcatgacctaccgagagcacacagcctgggtggtgaaggcgtacctgcagaag
catcctgaaggcaacatcatgagcgtcagtgtgaatggagacgtgcgcttcttcgacccc
cggatgccagagtccatgaaggtcctccagatagtcaaagggctgacagctcttgacatt
cacccgcaagccaacctctttgcatgtggctcaatgaatcagttcactgcaatctacaat
ggaaacggtgagctgatcaacaatatcaaatactacgatggttttatgggacaaagagtc
ggagccatcagctgcctggctttccatcctcactggcctcacctggcagtcgggagcaat
gactactacatctcggtgtactcggtggagaagcggatcagataa

DBGET integrated database retrieval system