KEGG   Gallus gallus (chicken): 428706Help
Entry
428706            CDS       T01006                                 

Gene name
DLG3
Definition
(RefSeq) discs large MAGUK scaffold protein 3
  KO
K21098  
discs large protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    428706 (DLG3)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     428706 (DLG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
4
AA seq 885 aa AA seqDB search
MIRREDTERAVEILTRYQSTLCSPEEQELKASIGKISHIFQSELFQALLDIHEFYDFTLR
SAPLQPPSPAVHRGTARHLSPREPHSPPEPPVQDGEQRLLAVTPATPPRLVRVTARRTEA
PTSVCSLVLGSRSALPQANPAPIIVNTDSLEQGLSVNGSDGMFKYEEIVLERGNSGLGFS
IAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALK
EAGPVVRLVVRRRQPPPETIMEVNLMKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGG
AAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAKPGSLHLNDMYAPP
DYASTFSALADNHISHNSSLGYLGGVESKPAYPVPPQVTPSRYSPIPRHMIGDEDFTREP
RKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNAT
HEQAAAALKRAGQTVTIIAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSL
YVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSK
KRVEKKERARLKTVKFHARTGMIESNRSIKTKRKKSFRLSRKFPFYKSKENLAQESSGQE
QGVTSNTSDSESSSKGQEDTILSYEPVTRQEIHYARPVIILGPTKDRINDDLISEFPHKF
GSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAV
AERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKVFDKAMK
LEQEFGEYFTAIVQGDSLEEIYSKIKQIIEDQSGHYIWVPSPEKL
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcagggaagacaccgaacgggccgtggaaatcctgacgagataccaaagcacc
ctgtgctccccagaggaacaggagctgaaagcctccatcggaaagatctcacacatcttc
caaagtgaactctttcaggctctgctggatatccacgaattctatgacttcactctgcgc
tcagcacccctgcagcctcccagcccagcagtgcatcgtggcacagcccggcacctcagc
cccagagagccccacagcccccccgagccaccggtccaggatggtgagcaaaggctgctg
gcggtgacaccggcgacgcccccaaggctggtgagggtgacagcacgccggacggaggca
ccaaccagtgtctgcagcctggtgctgggctcccgcagtgccctgccgcaggccaaccct
gctcccattatcgtgaacacagactcgctggaacaagggctctctgtgaacggcagcgat
gggatgttcaaatacgaggagatcgtcctggaaaggggtaactctgggctcggcttcagc
atagcaggagggatcgacaaccctcacattccagatgatcccggcatcttcatcaccaaa
atcatccccgggggagcagcggccatggatggacgtttgggggtaaatgactgcgtgctg
cgggtcaacgacgtggacgtctccgaggtggtgcacagcaaagcagtggaggccctgaag
gaagcgggccccgtggtgcggctcgtggtgcggcgccggcagcccccgccggagaccatc
atggaggtgaacctgatgaagggacccaaaggactgggcttcagcatcgcagggggcatt
gggaaccaacacatccccggggacaacagcatctacatcaccaagatcatcgagggaggc
gctgcccagaaggacgggcgcctgcagatcggagaccggctgctggcggtgaataacacc
aacctgcaggacgtgcggcacgaggaggcggtggccgcgctgaagaacacctcggacatg
gtgtacctgaaagtggccaagcctggcagcctgcacctcaacgacatgtacgcgcccccc
gactacgccagcaccttttcagccttggctgacaaccacataagccataactccagtctg
ggctacttgggtggtgtggagagcaagcctgcataccccgtccccccacaagtgaccccc
tccaggtattcgcccatccctcggcacatgatcggggatgaagacttcaccagggagccc
cgcaaaatcatcctgcacaaaggctccaccggcctgggcttcaacatcgtcgggggagag
gacggagagggtatcttcgtgtccttcatcctggccggaggccccgccgacctcagcggg
gagctgcggaggggagaccgcatcctgtcggtgaacggcgtgaacctccgtaacgccacc
cacgagcaggcggcggcggcgctgaagcgggcggggcagacggtgaccatcatcgcgcag
taccggcccgaagagtacagccgcttcgagtccaagatccacgacttgagagagcagatg
atgaacagcagcatgagctctggctctggctcacttcggacaagcgagaagaggtccctc
tatgtccgagctctgtttgactatgaccggacccgggacagctgcttacccagccagggg
ctcagcttctcctatggggacatcctccatgtcatcaatgcctctgatgatgagtggtgg
caagccaggcttgtgacacctcacggcgagagtgagcagattggagtcatccccagcaag
aagagggtggagaagaaggagagagcgcggttgaaaacggtgaagttccacgccaggact
ggcatgatagagtccaaccggtcgatcaaaacgaaacgtaaaaagagtttccgcctctct
cgaaagttcccattttacaagagcaaagagaacctggcccaggagagcagcggacaggaa
cagggcgtgacatcaaacaccagtgacagcgagagcagttccaaaggacaagaggacact
atcctgtcatacgagccagtgacacggcaagaaattcactacgccaggcctgtgatcatc
ctggggcccacgaaggaccgaatcaatgacgacctcatctctgaatttccacacaagttt
ggttcctgcgtgccacacaccaccaggcctcggcgtgataatgaggtggatggacaggat
taccacttcgtcgtctcccgagaacagatggagaaggatattcaagacaacaagttcata
gaggccgggcagttcaacgacaatctctacgggaccagcattcagtcggtgcgggcggtc
gcagagaggggaaaacactgcatcctggatgtatctggcaatgctatcaagaggttgcaa
caagcacaactttatcccattgccattttcatcaaaccaaaatccatcgaagcgctcatg
gagatgaaccggaggcagacatacgaacaggccaacaaggtctttgacaaagccatgaaa
ctcgagcaagaatttggagagtattttacagccatcgtacaaggagactccctcgaagag
atttacagcaaaatcaaacagatcatcgaggaccaatccgggcactacatctgggtcccg
tccccagagaagctctga

DBGET integrated database retrieval system