KEGG   Gallus gallus (chicken): 428728Help
Entry
428728            CDS       T01006                                 

Gene name
AADAT
Definition
aminoadipate aminotransferase
Orthology
K00825  
kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine biosynthesis
Lysine degradation
Tryptophan metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:gga01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gga01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gga00300]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gga00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:gga00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 428 aa AA seqDB search
MNYSRFITSVSAARKASPIRVLTELMQKSPPSLISLAGGAPNPAVFPFKKATIATGHGNA
VEIGEDLMKRALQYSASAGIPELLSWLKNFQRNLHNPPTANYSPEQGQMEVCVTTGSQEG
LCKVFEMLINPGDSILLDAPTYSGTLAALRPLGCSIINVPSDQHGIIPKALKEILSAWSP
EDIKNHSRPLPKFLYTIPNGCNPTGNSLTTDRKKEIYQIARKYDFLIIEDDPYYFLQFEK
PWAPSFLSMDVDGRVIRTDSFSKVLSSGLRVGFLTGPKPLIDRVILHIQVSTMHTSTFTQ
MIISQLLQQWGEKGFLEHTDRVVEFYRTQRDAMLIAADKWLKGLAEWHPPAAGMFLWIKI
KGVSDTQQLIMEKALQKEVLLVPGGVFNIDSSEPSPYVRASFSLPSPAQMDLAFQRLADL
IKEAVWKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcccggtttatcacaagtgtgagtgcagccagaaaagcatctccaataaga
gttctgactgaattgatgcaaaagtctcctccatctctcatctctctggctggaggggca
ccaaaccctgccgtttttccgtttaagaaggctactattgccactggacatggaaatgct
gttgagattggggaagacttaatgaagagggctcttcaatactctgcctcagcagggatt
ccagaactgttgtcgtggctaaagaattttcagaggaatctacacaatccccccacagcc
aactacagtcccgagcaaggacaaatggaagtgtgtgtcacaaccggcagccaggaaggc
ttgtgcaaagtgtttgaaatgctcattaatcctggggacagcatccttttggatgccccc
acatattctgggacactcgcagctctgagacctttgggctgtagcatcattaacgttcct
agtgaccaacatggcattattccaaaagctctaaaagaaattctgtctgcatggagtcca
gaagatataaaaaatcatagccgccctctccccaaattcctgtacacaatcccaaatggc
tgcaacccaactggaaactctctaaccacggatcgcaagaaggagatttatcagattgca
agaaaatatgatttccttataatagaagatgatccttactactttcttcagtttgaaaag
ccatgggctccaagtttcctctcaatggatgtggatggcagagtcatcaggactgactca
ttctctaaagttctctcatctgggttgagagtaggttttctgacaggccccaagcctctc
atcgacagagttattctacacattcaggtttctacaatgcacaccagcactttcacacag
atgataatatcacagcttcttcaacagtggggagaaaagggtttcttggagcacacagac
agagttgtggagttctacaggacccagcgggatgcaatgctcattgctgctgacaaatgg
ttaaaaggcttggcagaatggcatcctcctgctgctggcatgttcttatggatcaaaatt
aagggagtttctgatacacagcagctgatcatggaaaaagctttgcaaaaagaagtgtta
ctggttcctggaggagtgttcaacatcgatagttcagagcccagtccttatgtcagagct
tctttctctctgccttctccagcccagatggatctggctttccagagactggctgacctt
ataaaagaagctgtatggaaaaaatga

DBGET integrated database retrieval system