KEGG   Gallus gallus (chicken): 428728Help
Entry
428728            CDS       T01006                                 

Gene name
AADAT
Definition
aminoadipate aminotransferase
Orthology
K00825  
kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine biosynthesis
Lysine degradation
Tryptophan metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    428728 (AADAT)
   01230 Biosynthesis of amino acids
    428728 (AADAT)
  Amino acid metabolism
   00300 Lysine biosynthesis
    428728 (AADAT)
   00310 Lysine degradation
    428728 (AADAT)
   00380 Tryptophan metabolism
    428728 (AADAT)
Enzymes [BR:gga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     428728 (AADAT)
    2.6.1.39  2-aminoadipate transaminase
     428728 (AADAT)
Amino acid related enzymes [BR:gga01007]
 Aminotransferase (transaminase)
  Class I
   428728 (AADAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 428 aa AA seqDB search
MNYSRFITSVSAARKASPIRVLTELMQKSPPSLISLAGGAPNPAVFPFKKATIATGHGNA
VEIGEDLMKRALQYSASAGIPELLSWLKNFQRNLHNPPTANYSPEQGQMEVCVTTGSQEG
LCKVFEMLINPGDSILLDAPTYSGTLAALRPLGCSIINVPSDQHGIIPKALKEILSAWSP
EDIKNHSRPLPKFLYTIPNGCNPTGNSLTTDRKKEIYQIARKYDFLIIEDDPYYFLQFEK
PWAPSFLSMDVDGRVIRTDSFSKVLSSGLRVGFLTGPKPLIDRVILHIQVSTMHTSTFTQ
MIISQLLQQWGEKGFLEHTDRVVEFYRTQRDAMLIAADKWLKGLAEWHPPAAGMFLWIKI
KGVSDTQQLIMEKALQKEVLLVPGGVFNIDSSEPSPYVRASFSLPSPAQMDLAFQRLADL
IKEAVWKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcccggtttatcacaagtgtgagtgcagccagaaaagcatctccaataaga
gttctgactgaattgatgcaaaagtctcctccatctctcatctctctggctggaggggca
ccaaaccctgccgtttttccgtttaagaaggctactattgccactggacatggaaatgct
gttgagattggggaagacttaatgaagagggctcttcaatactctgcctcagcagggatt
ccagaactgttgtcgtggctaaagaattttcagaggaatctacacaatccccccacagcc
aactacagtcccgagcaaggacaaatggaagtgtgtgtcacaaccggcagccaggaaggc
ttgtgcaaagtgtttgaaatgctcattaatcctggggacagcatccttttggatgccccc
acatattctgggacactcgcagctctgagacctttgggctgtagcatcattaacgttcct
agtgaccaacatggcattattccaaaagctctaaaagaaattctgtctgcatggagtcca
gaagatataaaaaatcatagccgccctctccccaaattcctgtacacaatcccaaatggc
tgcaacccaactggaaactctctaaccacggatcgcaagaaggagatttatcagattgca
agaaaatatgatttccttataatagaagatgatccttactactttcttcagtttgaaaag
ccatgggctccaagtttcctctcaatggatgtggatggcagagtcatcaggactgactca
ttctctaaagttctctcatctgggttgagagtaggttttctgacaggccccaagcctctc
atcgacagagttattctacacattcaggtttctacaatgcacaccagcactttcacacag
atgataatatcacagcttcttcaacagtggggagaaaagggtttcttggagcacacagac
agagttgtggagttctacaggacccagcgggatgcaatgctcattgctgctgacaaatgg
ttaaaaggcttggcagaatggcatcctcctgctgctggcatgttcttatggatcaaaatt
aagggagtttctgatacacagcagctgatcatggaaaaagctttgcaaaaagaagtgtta
ctggttcctggaggagtgttcaacatcgatagttcagagcccagtccttatgtcagagct
tctttctctctgccttctccagcccagatggatctggctttccagagactggctgacctt
ataaaagaagctgtatggaaaaaatga

DBGET integrated database retrieval system