KEGG   Gallus gallus (chicken): 428728Help
Entry
428728            CDS       T01006                                 

Gene name
AADAT
Definition
(RefSeq) aminoadipate aminotransferase
  KO
K00825  
kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Tryptophan metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    428728 (AADAT)
  Amino acid metabolism
   00300 Lysine biosynthesis
    428728 (AADAT)
   00310 Lysine degradation
    428728 (AADAT)
   00380 Tryptophan metabolism
    428728 (AADAT)
Enzymes [BR:gga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     428728 (AADAT)
    2.6.1.39  2-aminoadipate transaminase
     428728 (AADAT)
Amino acid related enzymes [BR:gga01007]
 Aminotransferase (transaminase)
  Class I
   428728 (AADAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 428 aa AA seqDB search
MNYSRFITSVSAARKASPIRVLTELMQKSPPSLISLAGGAPNPAVFPFKKATIATGHGNA
VEIGEDLMKRALQYSASAGIPELLSWLKNFQRNLHNPPTANYSPEQGQMEVCVTTGSQEG
LCKVFEMLINPGDSILLDAPTYSGTLAALRPLGCSIINVPSDQHGIIPKALKEILSAWSP
EDIKNHSRPLPKFLYTIPNGCNPTGNSLTTDRKKEIYQIARKYDFLIIEDDPYYFLQFEK
PWAPSFLSMDVDGRVIRTDSFSKVLSSGLRVGFLTGPKPLIDRVILHIQVSTMHTSTFTQ
MIISQLLQQWGEKGFLEHTDRVVEFYRTQRDAMLIAADKWLKGLAEWHPPAAGMFLWIKI
KGVSDTQQLIMEKALQKEVLLVPGGVFNIDSSEPSPYVRASFSLPSPAQMDLAFQRLADL
IKEAVWKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcccggtttatcacaagtgtgagtgcagccagaaaagcatctccaataaga
gttctgactgaattgatgcaaaagtctcctccatctctcatctctctggctggaggggca
ccaaaccctgccgtttttccgtttaagaaggctactattgccactggacatggaaatgct
gttgagattggggaagacttaatgaagagggctcttcaatactctgcctcagcagggatt
ccagaactgttgtcgtggctaaagaattttcagaggaatctacacaatccccccacagcc
aactacagtcccgagcaaggacaaatggaagtgtgtgtcacaaccggcagccaggaaggc
ttgtgcaaagtgtttgaaatgctcattaatcctggggacagcatccttttggatgccccc
acatattctgggacactcgcagctctgagacctttgggctgtagcatcattaacgttcct
agtgaccaacatggcattattccaaaagctctaaaagaaattctgtctgcatggagtcca
gaagatataaaaaatcatagccgccctctccccaaattcctgtacacaatcccaaatggc
tgcaacccaactggaaactctctaaccacggatcgcaagaaggagatttatcagattgca
agaaaatatgatttccttataatagaagatgatccttactactttcttcagtttgaaaag
ccatgggctccaagtttcctctcaatggatgtggatggcagagtcatcaggactgactca
ttctctaaagttctctcatctgggttgagagtaggttttctgacaggccccaagcctctc
atcgacagagttattctacacattcaggtttctacaatgcacaccagcactttcacacag
atgataatatcacagcttcttcaacagtggggagaaaagggtttcttggagcacacagac
agagttgtggagttctacaggacccagcgggatgcaatgctcattgctgctgacaaatgg
ttaaaaggcttggcagaatggcatcctcctgctgctggcatgttcttatggatcaaaatt
aagggagtttctgatacacagcagctgatcatggaaaaagctttgcaaaaagaagtgtta
ctggttcctggaggagtgttcaacatcgatagttcagagcccagtccttatgtcagagct
tctttctctctgccttctccagcccagatggatctggctttccagagactggctgacctt
ataaaagaagctgtatggaaaaaatga

DBGET integrated database retrieval system