KEGG   Gallus gallus (chicken): 428832Help
Entry
428832            CDS       T01006                                 

Gene name
CYP1B1
Definition
cytochrome P450, family 1, subfamily B, polypeptide 1
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    428832 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    428832 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    428832 (CYP1B1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     428832 (CYP1B1)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP1 family
   428832 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 516 aa AA seqDB search
MSAMGTPNGAAMAPVLSPHSALLLIAVVLTAILLLARTRHKATRGQSPPGPFASPLVGNV
LQMGRLPHLTFMRMACRYGAIFQLRLGRHRVVVLNGEAAIRRALVGLGTRFAGRPDFPSF
GLVSGGRSIAFGGCTPQWRARRRLAHAALRAHSTVAEVERHVVAEAGDLVRLFLRHSQGG
AYFQPCPLLVVANANVLCALCFGRRYDHADGEFTALLGRNDRFGQTVGAGSLVDVLPWLL
RFPNPVRHVYRDFQALNRELHGFVQAKVAQHRQTFDWRAVRDISDVMIASVERGGGSPDG
LGPEDVEGAMTDIFGAGQDTTSTALSWIILLLLKHPQVQQDLQAELDRVVGRSRLPTAED
RPHLPLLEAFIYETLRYSSFVPITIPHATTADVELEGFRIPKGTVVFVNQWSVNHDCSKW
PEPQRFDPTRFLDKQQRLDRERAGSVMIFSAGQRRCIGDQLSKLQIFLFTAILLHQCSFH
ANPAEHLTMDCIHGLALKPLPFTVNVRPRIPLLIQP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgatggggacccccaacggggcggccatggcgccggtgctgtcgcctcactct
gcccttcttctcattgccgtcgtgctcactgccatcctgctgctcgccaggactcgccac
aaggccactcgtggccagagcccgccgggtcctttcgcgtcgcctctggtgggcaacgtc
ctgcagatgggccgcctgccccacctcaccttcatgcgcatggcgtgccgctatggagcc
atcttccagctgcgcctgggccggcaccgggtggtggtgctcaatggcgaggcggccatc
cggcgggcgctggtggggctgggcacgcgcttcgccggccggcctgacttcccttccttc
gggctggtgtcaggtgggcgcagcatcgcctttgggggctgcacgccccaatggcgggca
cggcggcggctggcccacgctgccctaagggctcattcaacggtggctgaggtggagcgg
cacgtggtggccgaggcgggtgacctggtgcggctcttcctgaggcacagccagggtggt
gcttacttccagccctgcccgctcttagtggtggccaacgccaatgtcctctgcgctctc
tgctttggccgccgctatgaccacgctgacggcgagttcaccgcgttgcttggccgcaat
gaccgctttgggcagacggtgggggctggcagtctggtagatgtactgccctggctcctg
cgcttccccaaccccgtccgtcatgtctaccgtgacttccaggccctcaaccgggagctg
cacggctttgtgcaggccaaggtggcacagcaccgccagacctttgactggcgggcagtc
cgtgacatcagtgatgtcatgatcgcctctgtagagcgtggtggtgggtcccctgatggg
ctgggacctgaggacgtggaaggtgccatgaccgacatctttggtgcggggcaggacacc
acgtccacggcgctctcatggatcatcctgctgctgctgaagcacccgcaggtccagcag
gaccttcaggctgagctggatcgggtggtgggacgcagccggctgcccacagctgaggac
cgaccccatctgccccttctggaggccttcatctacgagacgctgcgctacagcagcttt
gtgcccatcaccattccacatgccaccacggctgatgtggagctcgagggcttccgcatc
cctaagggcactgtggtctttgtcaaccagtggtcagtcaaccacgactgcagcaagtgg
cccgagccacagcgcttcgaccccacgcgattcctggacaagcagcagcgcctggaccgt
gagcgggccggaagcgtgatgatcttctcggctggccagcggcgctgcattggtgaccag
ctctccaagctccagatcttcctcttcaccgccatcctccttcaccagtgctccttccac
gccaacccagcggagcacctcaccatggactgcatccatgggctggcgctgaagccactg
cctttcaccgtcaacgtgcggccgaggatccccctgctcatccagccatga

DBGET integrated database retrieval system