KEGG   Gallus gallus (chicken): 428883Help
Entry
428883            CDS       T01006                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
gga  Gallus gallus (chicken)
Pathway
Focal adhesion
Class
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
5
AA seq 1505 aa AA seqDB search
MMAKNKEPRPPSYAVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDVTQSGEDGIDCRIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLSIDGFLLCIDVSQGCNRKFDDQLKFV
NNLYIQLSKSKKPIIIAATKCDECVDHYLREVQAFASNKKNLVVVETSARFNVNVETCFT
ALVQMMDKTRGKPKIIPYLDAYKTQRQLAVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEDYINLEGTKKAKNTFSKHIEQLKQEHIKKRKEEYINALPRALNTLLSNLDEIEHLS
WSEALKLMEKRPDFHSCFVVLEKTPWDETDHIDKVNDRRIPFDLLTTLEAEKVYQNHVQH
LISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVICFVMEDEAFKYITDADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHAVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCMDIKVEQLLANSLLQLDHGRSNLYHDSANIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYLLTQLWTSAFKPHGCFC
VFNSIESLNFIGDCIAKIRAEASQIRRDKYMANLPFTLILANQRDSVSKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLEAVKHHFDVVSPVPTIKDLSEADLRI
VMCAMCGDPFSVDLILSPFLESHSCSAAQAGQNNSVMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIESSYMSDSTRETTHT
SEDVFSRSPRGSSLDYNYPDSEDDAEGPPPYSPIGDDVRLLPTPSDRSKYRLDLEGNEYP
IHSTPLNCHDHERNHKVPPPIKPKPLVPRTNVKKLDPNLLKTIEAGIGKNPRKQPSRVPV
APPEDVDQSDNYAEPIDTIFKHKGFADDIYAVPDDSQNRIIKVRNSMPINAQGDEENGFS
DRISKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKAKRKGRHRGSEED
PLLSPVETWKGGIDNPAITSDQELDDKKTKKKTQKVKEDKKQKKKVKTFNPPIRRNWESN
YFGMPLQDLVTSEKPIPLFVEKCVQFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHSI
SLESMEVTVNAVAGALKAFFADLPDPLIPYSLHQELLEASKILDKTERLHELKEIVKKFH
PVNYDVFKYVITHLNRVSQQYKTNFMTADNLSICFWPTLMRPDFENREFLSTTKIHQSII
ETFIQQCQFFFYNGEIVEAPNPVACQPPPSNTVQMVEPMVPLQLPPPLQPQLIQPQLPAD
PLGII
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagccacgtcccccatcttatgctgttagtgttgttggactg
tctggaactgaaaaggataaaggtaattgtggagttggaaagtcgtgtttgtgcaataga
ttcgttcgttcaaaagcagatgaatattatcctgagcatacctctgtgcttagcacaatt
gactttggaggaagagttgttaacaatgatcactttttgtactggggtgacgtaacacaa
agtggggaggatggaattgactgcagaattcatgtaatcgaacagactgagttcattgat
gatcagactttcttgcctcatcggagtacgaacttacaaccatacataaaacgtgcagct
gcctccaaactgcagtcagcagaaaaactaatgtacatttgcacagatcagctgggcttg
gagcaagactttgagcaaaaacaaatgcctgaagggaaattaagcatagatggattttta
ctgtgcattgatgtaagccaaggatgcaataggaagtttgatgatcaacttaagtttgtg
aataatctctatattcagttatcaaaatctaagaaacccataataatagcagcaacaaaa
tgtgatgaatgtgtggatcattatctacgagaggtccaggcatttgcttctaataagaag
aaccttgtggtagtggaaacatcagcaagattcaatgtcaacgttgaaacttgttttact
gccctggtacaaatgatggataaaactcgtggtaagcctaaaataatcccctacttggat
gcctacaaaactcaaagacagctagctgttacagcaacagacaagtttgaaaaacttgtc
caaactgtgagagactatcacgctacttggaaaacagttagtaataaactgaaaaatcat
cctgattatgaagactacataaatttggaaggaacaaaaaaggccaaaaatacattttca
aaacacatagagcagcttaaacaggaacatattaaaaaaaggaaagaagaatacattaat
gcattgccaagagctcttaatactcttctgtcaaatctggatgagattgaacatttgagc
tggtcagaggctttgaagttaatggagaaaaggcctgacttccattcctgttttgttgtg
ctggaaaaaacaccctgggatgaaactgaccatatagataaagtgaatgacagaaggatt
ccatttgaccttctcactacgctagaggcagaaaaggtttatcaaaatcatgtgcagcat
cttatatctgaaaagaggaggattgaaatgaaggagaaattcaaaaaaactcttgagaaa
atccagttcatttcacctggacagccatgggaagaagttatatgttttgttatggaagat
gaggcgttcaaatacattactgatgcagatagtaaggaagtgtatggtaggcatcagaga
gagattgttgaaaaagccaaagaggagtttcaggaaatgctttttgaacactcagagcta
ttttatgacctggatcttaatgcaacaccaagttcagataagatgagtgaaattcatgca
gttctgagtgaagagcctagatacaaagctttgcagaaacttgcacctgatagagaatct
cttcttctcaaacacataggatttgtttatcatccaactaaagaaacttgtctcagtggc
caaaattgcatggacattaaagtagagcagttacttgccaacagtcttctgcagttagac
catggccgttcaaatttgtatcatgatagtgccaacatagataaggttaatcttttcatt
ttgggcaaagatggccttgcacaagagttagcaaatgaaattcggacacagtccactgat
gatgaatatgcgttagatggaaaaatatatgaacttgatcttaggccagttgatgcaaaa
tccccatacctgttgactcagttgtggacctctgccttcaaaccacatggttgtttttgt
gtgtttaactctattgaatcactgaattttattggggattgcattgcaaaaataagagct
gaagcatctcagataaggagagacaaatatatggctaatcttccctttacattaatactg
gctaatcagagggacagtgttagcaagaatctacctattctgagacatcagggacagcag
ttggccaacaaattacaatgtccattcgtagatgtgcctgctggtacatatccacgcaaa
tttaacgagacccaaataaaacaagctctgaggggagtactggaagcagttaaacaccac
tttgatgttgtgagtcctgttcccaccattaaagatctgtcagaagctgacttaagaatt
gtcatgtgtgctatgtgtggtgatccattcagtgtagatctcattctttcacccttcctt
gaatctcactcctgtagtgctgctcaggctggccaaaacaattctgtgatgcttgataaa
attataggtgaaaagaggcgtagaatacaaataactatattatcataccattcttcaatt
ggtgtaagaaaagatgaacttgttcatggatatatactggtttactccgcaaagcggaag
gcatccatggggatgcttcgggcatttctttctgaagttcaggatacaattcctgtccaa
ttggtggctgttacggatagccaggcagacttttttgagaatgaagctatcaaggagctc
atgactgaaggagaacacatagcaacagagattactgcaaagtttacagctttatattca
ttatctcaatatcatcgtcaaacagaggtcttcacgttattcttcagtgatgtattagag
aagaaaaacatgattgaaagttcctatatgtcagacagcacaagggaaacaacgcataca
agtgaggatgttttttcaaggtctcccagaggaagttcccttgactataattatccagat
tcagaagatgatgctgagggaccaccaccgtacagtccaattggtgatgacgtaaggtta
ctcccgacccctagtgaccgttcaaagtaccgattggacttggaaggaaatgagtatcct
attcacagtacgccactcaattgtcatgatcatgaacgcaaccataaagtgcctcctcca
ataaaaccgaaaccacttgttccaagaacaaatgtgaaaaaactggatcctaaccttttg
aaaacaatagaggcaggtattggtaaaaacccaaggaagcaaccttctcgagtgcctgta
gcaccaccagaagatgtagaccaatctgacaattacgctgaacctattgacactattttc
aaacataaaggctttgcagatgatatctacgcagttccagatgatagtcagaatcgtatt
attaaagttcgaaactcaatgcctataaatgcccagggcgatgaagaaaatgggttttct
gacagaatatctaaaagtcatggggaaagaagaccttcaaagtacaagtataagtctaag
acattgttcagcaaagctaagtcttattacaggagaacgcattcagatgcaagtgacgat
gaggcttttaccacttctaaagctaaaagaaaaggcaggcatcgtggtagtgaagaagac
ccacttctttcacctgttgaaacatggaagggtggcatagataaccctgctattacatca
gatcaagaattggatgataaaaaaacaaaaaagaaaactcaaaaagtgaaagaagataag
aagcaaaaaaagaaagttaagacattcaatcctccaatccgtagaaactgggaaagtaat
tactttggaatgcccctacaagacctggttacatctgagaaacccatacctctgtttgtt
gaaaaatgtgtgcaattcattgaagatacaggattatgtactgaaggcctgtaccgtgtt
agtggaaataaaacagatcaagacaacattcagaaacagtttgatcaagatcacagtatc
agtctagagtctatggaagtgacagtaaatgctgtggctggggctcttaaagcttttttt
gcagatctgccagatccattaataccttactctttgcatcaagagttgttagaagcatca
aagatcctggataagacagaacggctacatgagttaaaagaaattgtgaagaaattccac
ccagtgaactacgatgtcttcaaatacgtgataacacatctgaacagggttagtcagcaa
tataaaaccaactttatgactgctgataacttatcaatttgtttctggcctactttgatg
agacctgattttgaaaacagagagttcctttctaccaccaaaatccaccagtcaattata
gagactttcattcagcagtgtcagtttttcttttacaatggagagatcgtagaagcaccg
aacccagtggcatgtcagccaccaccttccaacacagtgcaaatggtggagccaatggta
cctctgcagttaccaccaccactgcagcctcagctgatacagccgcaattaccagcagac
cctcttggtattatataa

DBGET integrated database retrieval system