KEGG   Gallus gallus (chicken): 428969Help
Entry
428969            CDS       T01006                                 

Gene name
PGAM1
Definition
phosphoglycerate mutase 1 (brain) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    428969 (PGAM1)
   01230 Biosynthesis of amino acids
    428969 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    428969 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    428969 (PGAM1)
Enzymes [BR:gga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     428969 (PGAM1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   428969 (PGAM1)
  Exosomal proteins of melanoma cells
   428969 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
6
AA seq 254 aa AA seqDB search
MAAYRLVLVRHGESAWNLENRFCGWYDADLSPAGQQEARRGGEALRDAGYEFDICFTSVQ
KRAIRTLWNVLDAIDQMWLPVVRTWRLNERHYGALTGLNKAETAAKHGEAQVKIWRRSFD
IPPPPMQSDHPFFSTISKDRRYADLTEDQLPTCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctaccgcctcgtgctcgtccgccacggcgagagcgcctggaacctggagaac
cgcttctgcgggtggtacgacgccgacctcagccccgccgggcagcaggaggcgcgccgc
ggcggagaggccctgcgagacgccggctatgagttcgatatctgcttcacgtcggtgcag
aagagggccatccgcaccctctggaacgtgctggacgccatcgaccagatgtggctgccc
gtggtacggacgtggcgcctcaacgagcggcactacggggccctcaccggcctcaacaag
gccgagacggccgccaagcacggcgaggctcaggtgaagatctggaggcgctccttcgac
atccccccgccgcccatgcagtcggaccaccccttcttcagcaccatcagcaaggatcgt
cgctacgctgacctgacggaggaccagctgcctacatgtgagagcctgaaggacaccatc
gcccgggccctgcccttctggaatgaggaaatagtcccgcagatcaaagagggcaagaga
gtccttatcgcggcccatggcaacagcttgcgggggattgtcaagcatttggaaggcatg
tcagaagaggccatcatggaactgaacctgcccaccggtatcccaatcgtgtatgaattg
gacaagaacctgaagcccatcaagcccatgcagttcctaggagatgaggagacggtgcgc
aaggccatggaggctgtcgctgctcagggcaaagtcaagaaatga

DBGET integrated database retrieval system