KEGG   Gallus gallus (chicken): 429262Help
Entry
429262            CDS       T01006                                 

Gene name
IRS1, IRS-1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:gga04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:gga04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 1240 aa AA seqDB search
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGAPGVEYYENEKKWWHKSSAPK
RSIPLESCFNINKQVGDKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLPLHNRAKGHH
DGAAALGGGGGGSCSSSASLGEAGEDLSYGDGAPGPAFKEVWQVILKPKGLGQTKNLIGI
YRLCLTSKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTVPGEFWMQVDD
SVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRRHHINNPPPSQVGLSRR
SRTESVTATSPAGGVGGKPSSFRVRESSDGEGTMSPPDQQDGSPVSPSTNRTHAHRHRGS
ALLQPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSD
GGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPNGH
YILSRGANGHRCTPGTGLGTSPALAGDEQTSAADLDNRFRKRTHSAGTSPTITHQKTPSQ
SSVASIEEYTEMMPAYPPGGGSGGRAWPGRLSAFVPTRSYPEEGLEMHPLERRAGRTSPD
SSTLHTDDGYMPMSPGWPPVSSGRKGNGDYMSMSPKSVSTPQQIINPITGPSERVYPNGY
MMMSHSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVESSG
GKLLPCTGDYMDMYPVGDSNTSDPSLSYYGPEDPQHKPVLSYYSLPDAFKHPSGPGEPEE
GARHQHLRLSTSSGRLLYAATADDSSSSTSSDTLGGGYCGARLEPRLPHPHHQVLQPHLA
RKVDTSLAQTNSRLARPTRLSLGDPKASTLPRAREQQQQSQPFACPPEPKSPGEYVNIEF
GSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQERTGVE
MGRLGPAPPGAASICRPTAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIAAE
EVSLPRATIAAASSSSTTSASDWARQAPELAAHFVLLGGPQGPGGMSGSFTRANLSPNRN
QSAKVIRADTQGCRRIASSQTLSSTPSSTRWHTHVPLRAGAAVGGIRVSASSEQDVKPHS
SASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPP
PPPPPHQPLGSGESSSTRRSSEDLSAYASTSFQKQPEDRQ
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgcggccagcgaggctggggcc
cccggtgtcgagtactacgagaacgagaagaagtggtggcacaagtcgagcgcccccaaa
cggtcgatcccccttgagagctgcttcaacatcaacaagcaagtgggtgataagaacaag
cacctggtggctctctacacccgggacgagcactttgccatcgcggcggacagcgaggcc
gagcaagacagctggtaccaggctctcctaccgctgcacaaccgtgctaagggccaccac
gacggagctgcggccctcgggggaggtggtgggggcagctgcagcagctctgcgtccctt
ggtgaggctggggaggacttgagctacggtgacggtgccccaggacccgcattcaaagag
gtctggcaagtgatcctgaagcccaagggcctgggtcagacaaagaacctgattggtatc
taccgcctttgcctgaccagcaagaccatcagctttgtgaagctgaattcggatgcggct
gctgtggtgctgcagctgctcaatatccgccgttgcggacactccgagaacttcttcttc
atcgaggtgggacgctcggcggtgaccgtgcctggggagttctggatgcaggtggacgac
tcggtggtggcgcagaacatgcatgaaaccatcctggaggccatgcgagccatgagcgag
gaattccgaccccgcagcaagagccagtcctcctccaactgttccaaccccatctccgtg
ccccttcgcaggcaccacatcaacaaccctccgcccagccaagtggggctcagtcgccgg
tccaggaccgagagtgttacagccacctccccagctggcggtgtgggtggcaaacccagc
tctttccgggtgcgtgaatccagcgatggcgaaggcaccatgtccccgcctgaccagcaa
gacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgaggcagc
gcgctgctgcaacccccgctcaaccacagccgctccatccccatgccggcttcccgctgc
tcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccatggctcc
acctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttcccccagcgat
ggcggtttcatctcctcggatgagtatggctccagtccctgcgatttccggagttccttc
cgcagtgtcactccggattccctgggccacaccccaccagcccgcggtgaggaggagcta
agcaactatatctgcatgggtggcaaggggccctccaccctgaccgcccccaacggtcac
tacattttgtctcggggtgcgaatggccaccgctgcaccccaggaacaggcttgggcacg
agtccagccttggctggggatgaacagaccagtgctgcagatctggataatcgattccga
aagagaactcactcggcaggcacatcccctaccattacccaccagaagaccccgtcccag
tcctcagtggcttccattgaggagtacacagagatgatgcctgcctacccaccaggaggt
ggcagtggaggccgagcgtggccgggtaggctctccgccttcgtgcccacccgctcctac
ccagaggagggtctggaaatgcaccccttggagcgtcgcgcggggcgcaccagcccagac
agctccaccctccacacggatgatggctacatgcccatgtccccagggtggcccccagtg
tccagcggccgaaagggcaatggagactatatgtccatgagccccaagagcgtatctacc
ccacagcagatcatcaaccctatcacaggtccatccgagagagtgtaccccaatggctac
atgatgatgtcccacagcggtggctgctctcctgacattggaggtggccccagcagcagc
agcagcagcagcaacgccgtcccttccgggaccagctatggaaagctgtggacaaacggg
gtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagcagcggt
ggtaagctcttaccttgcacaggtgactacatggacatgtacccagtgggggactccaac
accagcgacccctccctgagctactatggccctgaggacccccagcacaagccagtcctc
tcctactactcattgccagatgcctttaagcaccccagcggacccggggagccggaggag
ggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctatgctgca
acagcagatgattcttcctcttccaccagcagcgacacgctgggtgggggatactgcggg
gctaggctggagccaaggcttccacatccccaccatcaggttctgcagccccatctcgct
cgaaaggtggacacaagcctggctcagaccaatagccgcctggcccggcccacgaggctg
tccctgggggatcccaaggccagcaccttaccccgggcccgggagcagcagcagcagagc
cagcccttcgcatgccctccagagcccaagagcccgggggaatatgtcaatattgaattt
gggagtgatcagtctggctacttgtctggcccggtggctttccacagctcaccttctgtc
agatgtccatcccagctccagccagctcccagagaggaagagactggcactgaggagtac
atgaagatggacctggggccgggccggagggcagcctggcaggagaggactggggtcgag
atgggcagactgggccctgcacctcccggggctgctagcatttgcaggcctaccgcagtg
cccagcagccggggtgactacatgaccatgcagatgagttgtccccgtcagagctacgtg
gacacctcgccagctgcccctgtaagctatgctgacatgcgaacaggcattgctgcagag
gaggtgagcctgcccagggccaccatagctgctgcctcctcatcctcaaccacctctgct
tccgactgggcccgacaggcaccagagctggctgcccacttcgtcctgctggggggccca
caggggcccgggggcatgagcggatccttcacccgggcgaacctcagtcctaaccgcaac
cagagtgccaaagtgatccgtgcagacacacaagggtgccggaggatagctagctctcag
actttatcctcaacacccagttccacccggtggcacacacacgtgcctcttcgagccggg
gcagcagtagggggcattcgcgtaagcgcgagcagcgagcaggatgtgaaaccccacagc
tctgcttcctttgagaatgtgtggctgaggcctggggagcttgggggagcccccaaggag
ccagccaaactgtgtggggctgctgggggtttggagaatggtcttaactacatagacctg
gatttggtcaaggacttcaaacagtgccctcaggagtgcacccctgaaccgcagcctccc
ccacccccaccccctcatcaacccctgggcagcggtgagagcagctccacccgccgctca
agtgaggatttaagcgcctatgccagcactagtttccagaagcagccagaggaccgtcag
tag

DBGET integrated database retrieval system