KEGG   Gallus gallus (chicken): 429262Help
Entry
429262            CDS       T01006                                 

Gene name
IRS1, IRS-1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    429262 (IRS1)
   04150 mTOR signaling pathway
    429262 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    429262 (IRS1)
   04920 Adipocytokine signaling pathway
    429262 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 1240 aa AA seqDB search
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGAPGVEYYENEKKWWHKSSAPK
RSIPLESCFNINKQVGDKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLPLHNRAKGHH
DGAAALGGGGGGSCSSSASLGEAGEDLSYGDGAPGPAFKEVWQVILKPKGLGQTKNLIGI
YRLCLTSKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTVPGEFWMQVDD
SVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRRHHINNPPPSQVGLSRR
SRTESVTATSPAGGVGGKPSSFRVRESSDGEGTMSPPDQQDGSPVSPSTNRTHAHRHRGS
ALLQPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSD
GGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPNGH
YILSRGANGHRCTPGTGLGTSPALAGDEQTSAADLDNRFRKRTHSAGTSPTITHQKTPSQ
SSVASIEEYTEMMPAYPPGGGSGGRAWPGRLSAFVPTRSYPEEGLEMHPLERRAGRTSPD
SSTLHTDDGYMPMSPGWPPVSSGRKGNGDYMSMSPKSVSTPQQIINPITGPSERVYPNGY
MMMSHSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVESSG
GKLLPCTGDYMDMYPVGDSNTSDPSLSYYGPEDPQHKPVLSYYSLPDAFKHPSGPGEPEE
GARHQHLRLSTSSGRLLYAATADDSSSSTSSDTLGGGYCGARLEPRLPHPHHQVLQPHLA
RKVDTSLAQTNSRLARPTRLSLGDPKASTLPRAREQQQQSQPFACPPEPKSPGEYVNIEF
GSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQERTGVE
MGRLGPAPPGAASICRPTAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIAAE
EVSLPRATIAAASSSSTTSASDWARQAPELAAHFVLLGGPQGPGGMSGSFTRANLSPNRN
QSAKVIRADTQGCRRIASSQTLSSTPSSTRWHTHVPLRAGAAVGGIRVSASSEQDVKPHS
SASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPP
PPPPPHQPLGSGESSSTRRSSEDLSAYASTSFQKQPEDRQ
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgcggccagcgaggctggggcc
cccggtgtcgagtactacgagaacgagaagaagtggtggcacaagtcgagcgcccccaaa
cggtcgatcccccttgagagctgcttcaacatcaacaagcaagtgggtgataagaacaag
cacctggtggctctctacacccgggacgagcactttgccatcgcggcggacagcgaggcc
gagcaagacagctggtaccaggctctcctaccgctgcacaaccgtgctaagggccaccac
gacggagctgcggccctcgggggaggtggtgggggcagctgcagcagctctgcgtccctt
ggtgaggctggggaggacttgagctacggtgacggtgccccaggacccgcattcaaagag
gtctggcaagtgatcctgaagcccaagggcctgggtcagacaaagaacctgattggtatc
taccgcctttgcctgaccagcaagaccatcagctttgtgaagctgaattcggatgcggct
gctgtggtgctgcagctgctcaatatccgccgttgcggacactccgagaacttcttcttc
atcgaggtgggacgctcggcggtgaccgtgcctggggagttctggatgcaggtggacgac
tcggtggtggcgcagaacatgcatgaaaccatcctggaggccatgcgagccatgagcgag
gaattccgaccccgcagcaagagccagtcctcctccaactgttccaaccccatctccgtg
ccccttcgcaggcaccacatcaacaaccctccgcccagccaagtggggctcagtcgccgg
tccaggaccgagagtgttacagccacctccccagctggcggtgtgggtggcaaacccagc
tctttccgggtgcgtgaatccagcgatggcgaaggcaccatgtccccgcctgaccagcaa
gacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgaggcagc
gcgctgctgcaacccccgctcaaccacagccgctccatccccatgccggcttcccgctgc
tcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccatggctcc
acctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttcccccagcgat
ggcggtttcatctcctcggatgagtatggctccagtccctgcgatttccggagttccttc
cgcagtgtcactccggattccctgggccacaccccaccagcccgcggtgaggaggagcta
agcaactatatctgcatgggtggcaaggggccctccaccctgaccgcccccaacggtcac
tacattttgtctcggggtgcgaatggccaccgctgcaccccaggaacaggcttgggcacg
agtccagccttggctggggatgaacagaccagtgctgcagatctggataatcgattccga
aagagaactcactcggcaggcacatcccctaccattacccaccagaagaccccgtcccag
tcctcagtggcttccattgaggagtacacagagatgatgcctgcctacccaccaggaggt
ggcagtggaggccgagcgtggccgggtaggctctccgccttcgtgcccacccgctcctac
ccagaggagggtctggaaatgcaccccttggagcgtcgcgcggggcgcaccagcccagac
agctccaccctccacacggatgatggctacatgcccatgtccccagggtggcccccagtg
tccagcggccgaaagggcaatggagactatatgtccatgagccccaagagcgtatctacc
ccacagcagatcatcaaccctatcacaggtccatccgagagagtgtaccccaatggctac
atgatgatgtcccacagcggtggctgctctcctgacattggaggtggccccagcagcagc
agcagcagcagcaacgccgtcccttccgggaccagctatggaaagctgtggacaaacggg
gtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagcagcggt
ggtaagctcttaccttgcacaggtgactacatggacatgtacccagtgggggactccaac
accagcgacccctccctgagctactatggccctgaggacccccagcacaagccagtcctc
tcctactactcattgccagatgcctttaagcaccccagcggacccggggagccggaggag
ggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctatgctgca
acagcagatgattcttcctcttccaccagcagcgacacgctgggtgggggatactgcggg
gctaggctggagccaaggcttccacatccccaccatcaggttctgcagccccatctcgct
cgaaaggtggacacaagcctggctcagaccaatagccgcctggcccggcccacgaggctg
tccctgggggatcccaaggccagcaccttaccccgggcccgggagcagcagcagcagagc
cagcccttcgcatgccctccagagcccaagagcccgggggaatatgtcaatattgaattt
gggagtgatcagtctggctacttgtctggcccggtggctttccacagctcaccttctgtc
agatgtccatcccagctccagccagctcccagagaggaagagactggcactgaggagtac
atgaagatggacctggggccgggccggagggcagcctggcaggagaggactggggtcgag
atgggcagactgggccctgcacctcccggggctgctagcatttgcaggcctaccgcagtg
cccagcagccggggtgactacatgaccatgcagatgagttgtccccgtcagagctacgtg
gacacctcgccagctgcccctgtaagctatgctgacatgcgaacaggcattgctgcagag
gaggtgagcctgcccagggccaccatagctgctgcctcctcatcctcaaccacctctgct
tccgactgggcccgacaggcaccagagctggctgcccacttcgtcctgctggggggccca
caggggcccgggggcatgagcggatccttcacccgggcgaacctcagtcctaaccgcaac
cagagtgccaaagtgatccgtgcagacacacaagggtgccggaggatagctagctctcag
actttatcctcaacacccagttccacccggtggcacacacacgtgcctcttcgagccggg
gcagcagtagggggcattcgcgtaagcgcgagcagcgagcaggatgtgaaaccccacagc
tctgcttcctttgagaatgtgtggctgaggcctggggagcttgggggagcccccaaggag
ccagccaaactgtgtggggctgctgggggtttggagaatggtcttaactacatagacctg
gatttggtcaaggacttcaaacagtgccctcaggagtgcacccctgaaccgcagcctccc
ccacccccaccccctcatcaacccctgggcagcggtgagagcagctccacccgccgctca
agtgaggatttaagcgcctatgccagcactagtttccagaagcagccagaggaccgtcag
tag

DBGET integrated database retrieval system