KEGG   Gallus gallus (chicken): 429286Help
Entry
429286            CDS       T01006                                 

Gene name
USP13
Definition
(RefSeq) ubiquitin specific peptidase 13 (isopeptidase T-3) (EC:3.4.19.12)
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     429286 (USP13)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   429286 (USP13)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   429286 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
9
AA seq 862 aa AA seqDB search
MQRAALFGGGDAQMAAGDLGELLVPYMPTIRVPKSGDRVYKTECAFSYDSPDSEGGLYVC
MNTFLGFGREHIERHYRKTGQCVYLHLKRHVIEKVPGASGGALPKRRNAKLFLDLEANGD
LSSDDFEYEDEAKLVIFPDHYEISLPNIEELPALVTIASDALLSAKSPYRKQDPDSWEEE
LQASKHAKSLVQLDNGVRIPPSGWKCSPRDLRENLWLNLTDGSVLCGKWFFDGSGGNGHA
MEHYKETGYPLAVKLGTITPDGADVYSFDEEEPVLDPHIAKHLAHFGIDMLQMQVAENGL
RDNDIKPRVSEWEVIQEAGVKLKPMYGPGYTGMKNLGNSCYLNAVMQAIFSIPEFQRAYV
GNLPRIFDYSPLDPTQDFNTQMAKLGHGLLSGQYSKPPMKSELIEQVMKEEHKPQQNGIS
PQMFKAFISKDHTEFSSNRQQDAQEFFLHLINLVERNPVGSENPSDVFRFLVEERTQCCQ
SRKVRYTERVDYIMQLPVAMEAATNKDELIAYELKRREAEAARRAPPELVRAKIPFSACL
QAFSEPTNVEDFWSSALQAKSAGVKTSRFASFPQYLVVQIKKFTFGLDWIPKKLDVSIDM
PDFLDISHLRAMGLQPGEEELPDIAPPIIIPEDPKDRMMNNFVESLDIDESSVMQLAEMG
FPLEACRKAVYYTGNLGAEVAFNWIIAHMEEPDFAEPLVVPVFGGAASSGVAGLGAVGLD
NQPPEEMVSIIISMGFQRSLAIQALKATNNNLERALEWIFSHPELEEEDGEPALNVMDLE
NHTNANILAEARSEGPRIKDGPGRYELFGFISHMGTSTMSGHYVCHLKKEGRWVIYNDLR
VCASERPPKDLGYIYFYHRIPS
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggccgcgctgttcggcggcggcgacgcgcagatggcggccggggacctgggc
gagctgctcgtcccctacatgcccaccatccgcgtgcccaagtccggggaccgggtctac
aagacggagtgtgccttctcctacgactctcccgattcagaaggaggtctctatgtgtgc
atgaacacgtttctgggatttggaagggaacacattgaaaggcattaccggaaaacagga
cagtgtgtatatttgcatctgaaacgacatgtgatagagaaggtaccaggggcatctggt
ggagctttaccaaaaaggaggaatgctaagctatttttagatctagaggcaaatggtgat
ctgagcagtgatgattttgaatatgaagatgaagcaaaactcgttatatttcctgatcac
tatgaaatttcattaccaaacatagaagagttaccagcactggtgacaatagcttctgat
gcactcctcagtgcaaaatcaccctacaggaagcaggaccctgactcttgggaagaagag
ctacaggcatctaagcatgccaaatcgcttgtgcagctagacaacggtgttagaattccc
cccagtggttggaagtgctcaccccgcgatcttcgggagaatctgtggctaaacctgaca
gatggttcagtgttgtgcgggaagtggttctttgatggtagtggagggaatggtcacgca
atggagcactacaaggagacgggttatcccctggcagtgaagttgggaaccatcactcct
gatggagcagatgtctattcctttgatgaagaggagccggttttagatccacatatagca
aagcatctggcacactttgggattgatatgctacagatgcaagtggcagagaatggtcta
agagataatgatataaaaccaagagtctctgaatgggaagtgattcaggaagctggtgtg
aaactcaagcccatgtatggcccaggatataccggcatgaagaacctgggaaatagctgc
tacctcaacgctgtcatgcaagccattttcagcatcccagagttccagcgagcgtatgtg
ggaaaccttccgagaatatttgactactccccgcttgatccaacacaagatttcaacact
cagatggctaaactgggacatggtctcctttcaggccagtattctaaaccacccatgaaa
tccgagcttattgaacaggtgatgaaagaagaacacaagcctcaacaaaatggaatatct
ccccagatgtttaaggcttttataagtaaagaccacacagaattttcctctaatagacaa
caagatgcacaggagtttttcctacatcttataaatctagtagagaggaatcctgtaggt
tcagaaaaccccagtgatgttttccgtttcctggtggaagagcgcacacaatgctgccag
tccagaaaagtccgctacactgagagggtagactatatcatgcagttacctgttgccatg
gaggcggcaacaaacaaagatgaattaattgcatatgagctgaaaaggcgagaagcagaa
gctgcaaggagagctccaccagaacttgtccgtgccaagatcccatttagtgcatgtttg
caggccttctctgaaccaaccaatgtagaagacttctggagcagtgcccttcaagcaaaa
tctgcaggagttaagacttctcgttttgcttcatttcctcagtacttagtggtgcagata
aagaagttcacctttggcctcgactggatacccaaaaagcttgatgtgtcgatagacatg
ccagatttcttagatatcagccaccttcgagccatgggcctccagccaggagaagaggaa
cttcctgacattgctcctcccattatcattcccgaagacccaaaagatcgtatgatgaac
aattttgtggagtctctagatattgatgagtcttcggttatgcaactggcagagatgggt
tttcctttggaagcatgtcggaaagctgtgtactatacaggcaacctgggtgctgaagtg
gctttcaactggatcattgcacatatggaagagccagactttgctgagccattggttgta
cctgtgtttggaggagctgcttccagtggtgtggctggcttaggggctgttggattggat
aatcaacctcctgaagagatggtctccatcatcatttccatgggcttccaaaggagctta
gcaattcaagctctgaaggcaacaaacaataacttggagcgtgcactggaatggatcttc
agccaccctgaattagaggaggaagatggggagcctgctttgaacgtgatggatttggag
aaccatacaaatgcaaatatccttgcagaggcaagatcagagggacccaggatcaaagat
gggcctggaaggtacgagctgtttgggttcatcagccacatgggaacatccacaatgagt
ggtcactatgtttgtcatctcaaaaaagaaggaagatgggtgatctacaatgaccttaga
gtctgtgcctcagaacgacctcccaaagatctgggctacatctatttttaccacaggata
ccaagttag

DBGET integrated database retrieval system