KEGG   Gallus gallus (chicken): 429286Help
Entry
429286            CDS       T01006                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 853 aa AA seqDB search
MQRAALFGGGDAQMAAGDLGELLVPYMPTIRVPKSGDRVYKTECAFSYDSPDSEGGLYVC
MNTFLGFGREHIERHYRKTGQCVYLHLKRHVIEKVPGASGGALPKRRNAKLFLDLEANGD
LSSDDFEYEDEAKLVIFPDHYEISLPNIEELPALVTIASDALLSAKSPYRKQDPDSWEEE
LQASKHAKSLVQLDNGVRIPPSGWKCSKCDLRENLWLNLTDGSVLCGKWFFDGSGGNGHA
MEHYKETGYPLAVKLGTITPDGADVYSFDEEEPVLDPHIAKHLAHFGIDMLQMQVAENGL
RDNDIKPRVSEWEVIQEAGVKLKPMYGPGYTGMKNLGNSCYLNAVMQAIFSIPEFQRAYV
GNLPRIFDYSPLDPTQDFNTQMAKLGHGLLSGQYSKPPMKSELIEQVMKEEHKPQQNGIS
PQMFKAFISKDHTEFSSNRQQDAQEFFLHLINLVERNPVGSENPSDVFRFLVEERTQCCQ
SRKVRYTERVDYIMQLPVAMEAATNKDELIAYELKRREAEAARRAPPELVRAKIPFSACL
QAFSEPTNVEDFWSSALQAKSAGVKTSRFASFPQYLVVQIKKFTFGLDWIPKKLDVSIDM
PDFLDISHLRAMGLQPGEEELPDIAPPIIIPEDPKALDIDESSVMQLAEMGFPLEACRKA
VYYTGNLGAEVAFNWIIAHMEEPDFAEPLVVPVFGGAASSGVAGLGAVGLDNQPPEEMVS
IIISMGFQRSLAIQALKATNNNLERALEWIFSHPELEEEDGEPALNVMDLENHTNANILA
EARSEGPRIKDGPGRYELFGFISHMGTSTMSGHYVCHLKKEGRWVIYNDLRVCASERPPK
DLGYIYFYHRIPS
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggccgcgctgttcggcggcggcgacgcgcagatggcggccggggacctgggc
gagctgctcgtcccctacatgcccaccatccgcgtgcccaagtccggggaccgggtctac
aagacggagtgtgccttctcctacgactctcccgattcagaaggaggtctctatgtgtgc
atgaacacgtttctgggatttggaagggaacacattgaaaggcattaccggaaaacagga
cagtgtgtatatttgcatctgaaacgacatgtgatagagaaggtaccaggggcatctggt
ggagctttaccaaaaaggaggaatgctaagctatttttagatctagaggcaaatggtgat
ctgagcagtgatgattttgaatatgaagatgaagcaaaactcgttatatttcctgatcac
tatgaaatttcattaccaaacatagaagagttaccagcactggtgacaatagcttctgat
gcactcctcagtgcaaaatcaccctacaggaagcaggaccctgactcttgggaagaagag
ctacaggcatctaagcatgccaaatcgcttgtgcagctagacaacggtgttagaattccc
cccagtggttggaagtgctcaaaatgtgatcttcgggagaatctgtggctaaacctgaca
gatggttcagtgttgtgcgggaagtggttctttgatggtagtggagggaatggtcacgca
atggagcactacaaggagacaggttatcccctggcagtgaagttgggaaccatcactcct
gatggagcagatgtctattcctttgatgaagaggagccggttttagatccacatatagca
aagcatctggcacactttgggattgatatgctacagatgcaagtggcagagaatggtcta
agagataatgatataaaaccaagagtctctgaatgggaagtgattcaggaagctggtgtg
aaactcaagcccatgtatggcccaggatataccggcatgaagaacctgggaaatagctgc
tacctcaacgctgtcatgcaagccattttcagcatcccagagttccagcgagcgtatgtg
ggaaaccttccgagaatatttgactactccccgcttgatccaacacaagatttcaacact
cagatggctaaactgggacatggtctcctttcaggccagtattctaaaccacccatgaaa
tccgagcttattgaacaggtgatgaaagaagaacacaagcctcaacaaaatggaatatct
ccccagatgtttaaggcttttataagtaaagaccacacagaattttcctctaatagacaa
caagatgcacaggagtttttcctacatcttataaatctagtagagaggaatcctgtaggt
tcagaaaaccccagtgatgttttccgtttcctggtggaagagcgcacacaatgctgccag
tccagaaaagtccgctacactgagagggtagactatatcatgcagttacctgttgccatg
gaggcggcaacaaacaaagatgaattaattgcatatgagctgaaaaggcgagaagcagaa
gctgcaaggagagctccaccagaacttgtccgtgccaagatcccatttagtgcatgtttg
caggccttctctgaaccaaccaatgtagaagacttctggagcagtgcccttcaagcaaaa
tctgcaggagttaagacttctcgttttgcttcatttcctcagtacttagtggtgcagata
aagaagttcacctttggccttgactggatacccaaaaagcttgatgtttcgatagacatg
ccagatttcttagatatcagccaccttcgagccatgggcctccagccaggagaagaggaa
cttcctgacattgctcctcccattatcattcccgaagacccaaaagctctagatattgat
gagtcttcggttatgcaactggcagagatgggttttcctttggaagcatgtcggaaagct
gtgtactatacaggcaacctgggtgctgaagtggctttcaactggatcattgcacatatg
gaagagccagactttgctgagccattggttgtacctgtgtttggaggagctgcttccagt
ggtgtggctggcttaggggctgttggattggataatcaacctcctgaagagatggtctcc
atcatcatttccatgggcttccaaaggagcttagcaattcaagctctgaaggcaacaaac
aataacttggagcgtgcactggaatggatcttcagccaccctgaattagaggaggaagat
ggggagcctgctttgaacgtgatggatttggagaaccatacaaatgcgaatatccttgca
gaggcaagatcagagggacccaggatcaaagatgggcctggaaggtacgagctgtttggg
ttcatcagccacatgggaacatccacaatgagtggtcactatgtttgtcatctcaaaaaa
gaaggaagatgggtgatctacaatgaccttagagtctgtgcctcagaacgacctcccaaa
gatctgggctacatctatttttaccacaggataccaagttag

DBGET integrated database retrieval system