KEGG   Gallus gallus (chicken): 429485Help
Entry
429485            CDS       T01006                                 

Gene name
ART1, ART7.1
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     429485 (ART1)
Cellular antigens [BR:gga04090]
 Proteins
  429485 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 298 aa AA seqDB search
MEHAILGLVLLLSTRTDASAARSKKGPIKEVAMDMAPHSFDDQYQGCIHLMEAELEELNR
TEFANEVYAEEWRNATEKWQRRWGRVSSPMVLQQDQAIAVLAYTMEGELYRVFNNATLTA
GRSRQHYLSSYPFKTLHFLLSRALHTLRESQPQPCYNVFRGVNNTRFTAQQGTVVRFGQF
TPSSFKREVAESFGLDTFFSVETCYGAHIKDLSNFPEEDEVLIPPFEQFRVTNSTYTEGR
SFIQLRSHGKSSTYNCEFVKGKGCSAPEWGAWVDRGHRGPGAWGGCAGCAPSAAPHSH
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgccattctgggcttggtgctgctgctcagcaccaggactgatgcatcggct
gccaggagcaagaaaggccccataaaggaggtggcgatggacatggccccccactccttt
gatgaccagtaccagggctgcatccacttgatggaggctgagctggaggagctgaaccgc
accgagttcgccaacgaggtctatgctgaggaatggagaaatgccacagagaagtggcag
cgccgatggggtcgggtctccagcccaatggtgctgcaacaggatcaagccatagccgtg
ctggcgtatacaatggagggagaactgtaccgtgtgttcaacaacgccacgctcacggct
gggcgctcccggcagcactacctgagctcctaccccttcaagacactgcatttcctattg
agcagagccctgcacaccctgcgggaatcccagccccagccatgctacaacgtcttccgt
ggtgtgaacaacaccagattcacagcacagcaaggcacggtggtccgctttggccagttc
accccctcctccttcaaaagggaagtcgctgaatcttttggcctggacacgttcttctcg
gtggagacctgctatggtgcgcacatcaaggacctctccaatttccctgaagaggacgaa
gtcctcatcccacccttcgagcaattcagggtcaccaactccacctacaccgagggaaga
agcttcatccagctccgctcccacgggaagagcagcacctacaactgcgagttcgtgaag
ggtaagggctgcagtgctccagaatggggagcttgggtggatcggggacaccgaggaccg
ggagcgtggggaggctgtgcaggctgtgctccatctgcagccccccacagccattaa

DBGET integrated database retrieval system